SecReT6
Protein ID: 294504694
SecReT6 ID393
T6SS typei3
Gene symbol-
Locus tagYPZ3_2584
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3333355..3333894 [-]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDD5B0M1
KEGG IDypz:YPZ3_2584
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-36, Aligned region: 22..172
Protein Sequence: 179 a.a.     [Download]
>gi|294504694|ref|YP_003568756.1| type VI secretion lipoprotein, family [Yersinia pestis Z176003]
MNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIALYTLKST
DEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYP
LPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 540 bp     [Download]
>gi|294502110|ref|NC_014029.1|:c3333894-3333355 Yersinia pestis Z176003 chromosome, complete genome
ATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGA
CGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTACCGTCGAAATCGCGACAGCAGC
GGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCACTTTATACACTCAAGAGCACC
GATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGG
ATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGAGCTGACACTTGATGCTGGCGT
TACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGTGGAAAGCGGTTATTTATCCG
TTGCCCAAAAAACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAAGATCCGATCA
TGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA