SecReT6
Protein ID: 294504696
SecReT6 ID393
T6SS typei3
Gene symbol-
Locus tagYPZ3_2586
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3334979..3336481 [-]
Producthypothetical protein
NoteTssC
UniProt IDD5B0M3
KEGG IDypz:YPZ3_2586
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-194, Aligned region: 68..494
Protein Sequence: 500 a.a.     [Download]
>gi|294504696|ref|YP_003568758.1| hypothetical protein YPZ3_2586 [Yersinia pestis Z176003]
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDAYKSIASI
IAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQ
SPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQEL
SNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVW
SNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNG
FIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRMV
AKLPSLKDVA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|294502110|ref|NC_014029.1|:c3336481-3334979 Yersinia pestis Z176003 chromosome, complete genome
ATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGACGGAATATAGCGATTTTAATA
CATTACTGACTAAAGAATTTAAAGCGAAGTCTGAGCAAACGATAGCCGCAGTAGAAGGTGCCGTTAAAAC
GTTGGCTGAGCAAGCGCTGGCTAATTCGGTCACGGTGTCAGACGATGCTTATAAAAGTATTGCTTCCATT
ATTGCAGAGATTGATCGCAAGCTATCAGATCAGATTAACTTAATTTTGCACCACCAAGAATTCCAGTCTC
TGGAAAGCGCATGGCGTGGGCTGCACTATTTAGTCAATAACACCGAGACTGATGAGAAGTTGAGATTACG
TTTCCTCGACATTTCTAAAGATGAATTACGCCGTAACATGAAGCGTTATAAAGGTGTTGCTTGGGATCAA
AGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAATTGGGTGGCGAACCATACGGTTGCCTGG
TAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGCTTCAATTGGCAAAGTTGCCGC
TTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAAATGGAATCTTGGCAAGAACTG
TCAAACCCACGTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATGCCGCATGGAACTCACTGCGTC
AGTCTGAAGACTCTCGCTATATCGGCCTGGCGATGCCACGTTTCTTGTCGCGTCTGCCTTATGGGATTAA
CACCAATCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGATGGCGCGGATCACAGCAAATATGTGTGG
TCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGATCTTTCAAAGAGTATGGCTGGTGTACGCTGA
TTCGTGGTGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATACCTTCCCGACGGATGACGGCGG
TATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAACTGGCCAAGAATGGC
TTTATTCCACTGGTTCACAGAAAGAATACGGATTACGCGGCATTCATTGGCGCGCAGTCCCTGCAAAAAC
CTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGCTCGTCTGCCATACCTGTTTGC
TTGTTCACGTTTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATCGGCTCTTTTAAAGAGCGTGAT
GAGATGCAACGTTGGTTGAATGATTGGGTGATGAACTATGTTGATGGTGACCCAGCTAACTCTTCCCTGG
AAACTAAAGCGCGCCGTCCTTTAGCCGCCGCTGAAGTGATTGTTGAAGAAGTTGAAGGTAACCCTGGTTA
CTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTAGAAGGTTTGACAGTATCCCTGCGTATGGTT
GCTAAACTGCCTTCGCTGAAAGACGTAGCATAA