SecReT6
Protein ID: 294504697
SecReT6 ID393
T6SS typei3
Gene symbol-
Locus tagYPZ3_2587
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3336505..3337029 [-]
Producthypothetical protein
NoteTssB
UniProt IDD5B0M4
KEGG IDypz:YPZ3_2587
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-59, Aligned region: 11..164
Protein Sequence: 174 a.a.     [Download]
>gi|294504697|ref|YP_003568759.1| hypothetical protein YPZ3_2587 [Yersinia pestis Z176003]
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNF
DERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKA
GAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 525 bp     [Download]
>gi|294502110|ref|NC_014029.1|:c3337029-3336505 Yersinia pestis Z176003 chromosome, complete genome
ATGGTTAGCAAAAGTAATTCTCAAAAGTTTATCGCTCGAAACCGAGCGCCACGCGTGCAGATTGAATACG
ATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTATGGGGGTATTAGCAGATTTATC
CGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTAGATATCGATATTGATAATTTC
GATGAGCGCATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGAATACATTGACTGGGGAAGGCC
AGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGACGCTATCGCGAAAAAAGTTGA
TTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAGACTTATATGGATGGTAAGGCT
GGTGCTGAGGAATTAGTTATGAAATTGCTGAAAGACAAATCATTACTGACAACGCTTGCATCCGCACCGA
AAGCAAAACAATCCGCTGTTGATACTCCACAGTAA