SecReT6
Protein ID: 294504705
SecReT6 ID393
T6SS typei3
Gene symbol-
Locus tagYPZ3_2595
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3347017..3348852 [+]
Producthypothetical protein
NoteTssF
UniProt IDD5B0N2
KEGG IDypz:YPZ3_2595
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.30E-195, Aligned region: 1..610
Protein Sequence: 611 a.a.     [Download]
>gi|294504705|ref|YP_003568767.1| hypothetical protein YPZ3_2595 [Yersinia pestis Z176003]
MREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVYPNYNS
PTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWPLEIAEARLSSVPPDM
PNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHG
ETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEI
IILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQ
QAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEVFVSLVDQQEAPYGDS
LRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDESAWRLIRQLSFNYLP
LSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGF
SGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|294502110|ref|NC_014029.1|:3347017-3348852 Yersinia pestis Z176003 chromosome, complete genome
ATGCGCGAGATGGCGCAAGAGTTTGCTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGA
TTGAAGTCGCCGACCCTTACGTTGAGCGGCTGATAGAGTCCTTCTGTTTTTTATCTGCCAGAACGCAGAT
TAAGTTGGATGCTGAGTTTCCTAAATTTACTCAGCGTCTTTTGGACATTGTCTATCCCAATTACAATTCG
CCAACCCCCTCAATGGGCGTGATCCAACTTAAGCCAAATCTGAAGGAAGGAGATTTGACTCAAGGGTATT
GTGTTCCCAGGGGCAGCTCGTTCTTCACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGCAG
TGGTCAGGATGTGGAGTTGTGGCCACTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATG
CCTAATCTGGAAAAGCACCGCATTGCCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAG
TGGGCGATCTCACTTTCTCACAATTAGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACG
AATCGTTTCACATATCTTCGAGCTACTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGA
GAGACAGCAAAAGACACCGTGATCAGTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCC
TACTGCCGCTATCATGGAATATCTTTCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCG
TTTCTACTTTTTTACGCTGACACAGCTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATC
ATCATCCTACTGGACAGATTACCGCAGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCT
GCACGCCAGTGATTAATCTCTTTCCTAAACGCATGGATAAGATCGAAATTAACCGTGCACTGAACGATTT
TCACGTAGTACCAGACCGTAGCCGCCCACTGGATTATGAGGTTTTCGCCATTAATAAAGTGTTTGGTCAA
CAGGCGGAAACCAGCAACGAGGTGGTATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACT
TTGGGCGTTATTTCTCCATCACCCGCAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCG
CACGCCTTACGCCAGTACCGAGGTCTTTGTCTCGTTGGTCGATCAACAAGAGGCTCCTTATGGCGATAGC
TTGCGCTACCTCTCTATTGAAGCTCAGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTA
ATTTTGAATTGACCATGTCGGATTCAGCGCCCGTTCACGGTGCCCGGTTTGTCTTCCAACCCAGCGCCCC
ACGCGCCCCCTTTGCCATGGATGAATCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCA
CTGTCAGATATGTCCCACTCGAATGGGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTT
CAGACCATGAATCGAATACACAAATTGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTT
ACCCGGCAATGGCCTACTGGTTTATGGCCGGGGCATCTGCTGCACTTTGACCGTGGATGAAGAAGGATTC
TCCGGTATCAGCCCTTATCTATTTGGCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATG
TGTTTACCGAGACCGAGCTAAACTCCATGCAAAGAGGACGTGTCGGTCATTGGAAAGCCCGCCCTGGCAG
ACGAGGAGTCCTGTAA