SecReT6
Protein ID: 294505193
SecReT6 ID394
T6SS typeN/A
Gene symbol-
Locus tagYPZ3_3084
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3953001..3953645 [+]
Producthypothetical protein
NoteTssF
UniProt IDD5B3K2
KEGG IDypz:YPZ3_3084
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.50E-66, Aligned region: 7..214
Protein Sequence: 214 a.a.     [Download]
>gi|294505193|ref|YP_003569255.1| hypothetical protein YPZ3_3084 [Yersinia pestis Z176003]
MKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRP
SVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPID
RLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQTGQ
HALM
 
Nucleotide Sequence: 645 bp     [Download]
>gi|294502110|ref|NC_014029.1|:3953001-3953645 Yersinia pestis Z176003 chromosome, complete genome
GTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTCGCAGTGATGAATCGAAGC
TGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGAGTTGCCGCTGTCGTTGCG
CGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTCCGCAATATTACCCGTCCT
TCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCTCCAATATGTCGTTGAACT
ACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGATTTCCCAAGCCTGCATAA
CCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATTGAAACACAACCGATTGAC
CGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGGAGCAAGGCGCTTTTAGCT
CTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGCTTCTTCTCACTGTATGCCAGCGTCAATGC
GTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAATGTTACGAATGGCCGGTACAGACAGGTCAA
CATGCACTGATGTAA