SecReT6
Protein ID: 294505194
SecReT6 ID394
T6SS typeN/A
Gene symbol-
Locus tagYPZ3_3085
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3953609..3954697 [+]
Producthypothetical protein
NoteTssG
UniProt IDD5B3K3
KEGG IDypz:YPZ3_3085
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-93, Aligned region: 38..348
Protein Sequence: 362 a.a.     [Download]
>gi|294505194|ref|YP_003569256.1| hypothetical protein YPZ3_3085 [Yersinia pestis Z176003]
MAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPANEA
IRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFN
HRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEV
ICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLL
CINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDP
EQKPSVTIGVME
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|294502110|ref|NC_014029.1|:3953609-3954697 Yersinia pestis Z176003 chromosome, complete genome
ATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGGTTGAGAATG
TAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTTTCAATTGGT
CGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCCAATGAAGCC
ATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACACCTCCGCCC
GAGGTCAATTTGAGTTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACCAGGATATTA
CCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGCTAACGGATTTCATGAACGTATTCAAC
CACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTGACAATGGCG
GTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCGCAATAAATT
GCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAGAGCACCTGAAGTG
ATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGCTACGCAAAG
TGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCAAGAAATATGATGA
AAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAATTCTTGTTG
TGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACGCCTCGTTAG
TGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGCCTTGGGTTGGCCGAGCAACA
GGTGGGCGGGATGGTGTTGGGAACCGAGCAAAATAGCCTATTGGGCTGGACCAGTATCCTCGGCGATCCC
GAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA