SecReT6
Protein ID: 294505195
SecReT6 ID394
T6SS typeN/A
Gene symbol-
Locus tagYPZ3_3086
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3954823..3956139 [+]
Producthypothetical protein
NoteFha
UniProt IDD5B3K4
KEGG IDypz:YPZ3_3086
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0047, Aligned region: 34..100
FHA [PF00498], Evalue: 0.0047, Aligned region: 224..239
Protein Sequence: 438 a.a.     [Download]
>gi|294505195|ref|YP_003569257.1| hypothetical protein YPZ3_3086 [Yersinia pestis Z176003]
MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSIQDQGGNISPSQFAIEWRDGSFCLRM
LNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEG
EPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPK
DSAMDQAFIDLPQISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKT
LKATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLH
HQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMYKNYYNELASSRQQGFEKLFGE
VYEQAYDRALRQGMKDSE
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|294502110|ref|NC_014029.1|:3954823-3956139 Yersinia pestis Z176003 chromosome, complete genome
ATGGATAAAAAACAACCAACGCTGTCATTGCGGGTCGTCAACAGCGATAAATTAGAGAGTGGCAAACAAG
CCAGCAGCCTGTTTCATACGCAAGGGGGCAGTGTCGGCAGTGACGGTAGCCATCATTGGTCGATTCAGGA
CCAAGGCGGCAATATCAGCCCGTCACAGTTTGCTATTGAATGGCGTGATGGCTCTTTCTGCCTGCGGATG
CTGAATGGCTCTCTGAACATTAATCATTCGATGCTGACACCCAATTCGGGTTTCGTTCGCCTACAGCAAG
GGGATGAAATGACGTTGGGTAATCTGGTGATCAAAAGCCATATCAGCCGTTCTGCTGCCGATATGATCGA
TCCACTGATGGTGTCACCGGAGTCACTGGTATCGAGTTACAGCAACCCGATGGATGCCATGATGGAAGGG
GAGCCGTTGGCCTCGCCTCATCATCAGCAAGACAGCCGGTTAGCCGCGACGGTTAGCCATAATTTCAGCC
ATGATCCATTGCGGGTATTGGAAACTGAAAGCCTGACCACGCAAGGCCATGACGCCGTGATATCTGATGC
TGATCACTCTCTACAGCAGGACCGATACCGTAACCCACTTTTCTCTTCCCCGCTCTCTGATACCCCCAAG
GACAGTGCTATGGATCAGGCGTTTATCGATCTCCCGCAGATCAGTACCTTTCTTAACGGTAAACAAGCGG
GGGGCAAACCAGAAGGATTAAATAACCAAATGGAACAACATCACGTTGCCATTACGCCGCTGATGCGTGG
TTTTGACGCTCAACTCCCGATCCGCAACAGCCAGGAAGCTCACGATTTCCTTGAAGAGGCGGGTAAAACA
CTCAAAGCGACAATCGAAGGTCTGCTCGCCTTACAACGCAGCCAACATGGCTTGCGTGATAAGCACTTAC
GGCCGATTGAAGATAATCCATTGCGTCTGAATATGGATTACGACACCACCCTCAACTTGATGTTTGCCGA
TCAAAAAAGCCCGGTTCATCTTTCAGCGCCCGCCGCCGTGGCCGAAAGCCTGGATAACCTGCGTTTGCAT
CATCAGGCCAATCAACAGGCGATTACGCAAGCCTTGAACACCATGTTGGAAGCCTTCTCCCCTGAGCGTT
TACTGACGCGTTTTACCCATTATTTGCGCAGTAATGAGCGGCAAGAGCAGGACTCCGCCTGGGCGTGGGA
TATGTACAAAAACTACTATAACGAGCTGGCCTCCAGCCGCCAGCAAGGTTTTGAAAAACTGTTTGGCGAA
GTGTATGAGCAAGCCTATGACCGGGCCTTACGTCAAGGCATGAAGGATAGCGAGTAA