SecReT6
Protein ID: 294505202
SecReT6 ID394
T6SS typeN/A
Gene symbol-
Locus tagYPZ3_3093
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3962897..3964285 [+]
Producthypothetical protein
NoteTssA
UniProt IDD5B3L1
KEGG IDypz:YPZ3_3093
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-16, Aligned region: 53..112
DUF1020 [PF06255], Evalue: 0.01, Aligned region: 111..144
Protein Sequence: 462 a.a.     [Download]
>gi|294505202|ref|YP_003569264.1| hypothetical protein YPZ3_3093 [Yersinia pestis Z176003]
MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQAMALLSQKSKD
FRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSFSQRADE
AQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAATPVSPSL
AIDNTSDRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLA
RLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTDMTP
FLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLFEKA
GLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|294502110|ref|NC_014029.1|:3962897-3964285 Yersinia pestis Z176003 chromosome, complete genome
ATGGATATCACGTCACAACATCCCTGGCATGTCTTGTTACAAGCCCCTTTGTCACCTGAGCAGACCGCAC
AAGCCCTGGCCGATGATGACCCCCAATGGGAATATATCGACGGCCAGATGGTGAAACTGGGGTCATTGGC
CCACGCCACGCTGAATATTGATGATATTCAGCAACAAGCCATGGCGCTGTTATCACAGAAAAGTAAAGAC
TTCCGGCTCGTGGTGCATCTACTGCGCACCCTACAACACGGGGGCCAGCCAGATGAATTAATGCTGGCGA
TGTCGTTGCTGACCGAATACGTCCAGCTATTTTGGACTACGGCCTGGCCGCAAAATCCTTTACACAAACG
GCGCTTTGCTCAACAAATCCTAAAACGCTTTGACAGCGCCAGCAGCAGTTTTAGCCAACGAGCGGACGAG
GCTCAACGTGAGAATGTGCAAGGATTATTGGCACATTTAGCACAGGTTTGGCATAGCCGTGAGCCGGGTC
TGGCTAAAGAGGTGGATGCATTACGCAGCCGCTATGCGCGGCCACCGGAGCGGGTTATCGAGGCAGTGGC
TTCTGATGAACCGCTCTCATCCAACACCTTGGCGGCGGCAATGGCCGCCACCCCCGTTAGCCCAAGCCTC
GCCATAGATAACACGAGCGACAGAGCCTGGCGGCAGACCTTGCTGAAAATGGCGGATCTACTCAGCGAAC
AGCAACCCGATGCCGCTATCGGTTTCCGGCTACGCCGCCATGCCGTATGGGGCGCGTTAACCGCACCACC
TATGGCGCAGAGCGATGGCCGCACCCCGTTAGCCGCGGTATCTGCGGATCGAACCGCCGATTACTTAGCA
CGTCTGGCTAATGCCGATTTGCCTTTGTGGCACCAAGTGGAGCAGAGCCTCACCCTCGCGCCTTATTGGC
TGGATGGACATGTGCTTTCGGCACAAATCGCCCTGCAACTGGGTTATGACGCGGTGGCACAGGCTATCCG
TGATGAACTCAGCGTTTTTTTAGCCCGTATTCCCGCATTAAAAACCCTCTTTTTTACGGATATGACGCCA
TTCCTCTCCTCTGAATCTGCCGCCTGGTTACAGCAGGATGCGAATCATCAGGGAAGAAGTCGCACTATTG
AACAGGATGAAATTTGGCAATGCTATCAACAGCAAGGATTGGAAGCCGCACTACAGATGATAAACCGGCA
ACCACAGCAATCCGAACCTCGGGACCGTTTTTACCATCAATTGCTCAGTGCACAGTTGTTCGAAAAAGCA
GGGTTAACCGCATTGGCGCAGCAGCACTACCACAGCTTATTACTGGTAGGGCAGCAATTACAGCTAAGCG
AATGGGAACCTGCGTTGATCGCTCTACTGACAGAAAAACAGCGACAACTCAAACCATGA