SecReT6
Protein ID: 294505378
SecReT6 ID799
T6SS typei1
Gene symbol-
Locus tagYPZ3_3269
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]4187741..4188238 [-]
Producthypothetical protein
NoteTssB
UniProt IDD5B4H1
KEGG IDypz:YPZ3_3269
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-57, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|294505378|ref|YP_003569440.1| hypothetical protein YPZ3_3269 [Yersinia pestis Z176003]
MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGVREETSIEERQVVSVNKNNFNSVMNE
ANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFSPDNVAKKVPELKKILELREALVALKGPLGNIPAFRS
RLQDLLGNEDMREQLLKELDILNQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|294502110|ref|NC_014029.1|:c4188238-4187741 Yersinia pestis Z176003 chromosome, complete genome
ATGAGTAAAAATAAGCAAAGCAGTGTTGCCCCAAAAGAAAGGATTAACATCAAGTATGTGCCGAATACTG
GCGACCAGGTTGCAGAAATTGAATTACCGCTGAATCTGCTGGTTGTGGGTGATCTTAAAGGCGTGCGTGA
AGAGACTTCAATTGAAGAGCGTCAGGTTGTTTCGGTCAATAAGAATAACTTCAACTCAGTCATGAACGAA
GCAAATATCAGTCTGAGTTTCAATGTGCCTAATCGCCTTGAAGGTGATGGGGAAGAAGACATGCCGGTCG
CCTTGTCGATCAAGGGTCTTGATGATTTCTCGCCTGACAATGTGGCGAAAAAAGTTCCAGAGCTCAAAAA
AATTCTGGAACTACGGGAAGCGTTAGTGGCATTGAAAGGGCCATTGGGGAATATCCCAGCTTTCCGCTCT
CGTCTACAGGATTTGCTTGGCAATGAAGATATGCGCGAGCAGTTGCTGAAAGAATTGGACATTCTTAATC
AAAAATAA