SecReT6
Protein ID: 295681033
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6236
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]691334..694078 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD5WLK0
KEGG IDbge:BC1002_6236
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.50E-39, Aligned region: 249..331
AAA_2 [PF07724], Evalue: 2.50E-39, Aligned region: 405..417
AAA_2 [PF07724], Evalue: 2.50E-39, Aligned region: 513..569
AAA_2 [PF07724], Evalue: 2.50E-39, Aligned region: 640..805
AAA [PF00004], Evalue: 1.90E-21, Aligned region: 251..382
AAA [PF00004], Evalue: 1.90E-21, Aligned region: 645..729
AAA_5 [PF07728], Evalue: 8.70E-15, Aligned region: 251..329
AAA_5 [PF07728], Evalue: 8.70E-15, Aligned region: 382..417
AAA_5 [PF07728], Evalue: 8.70E-15, Aligned region: 644..762
ClpB_D2-small [PF10431], Evalue: 3.80E-13, Aligned region: 812..883
AAA_16 [PF13191], Evalue: 4.90E-12, Aligned region: 51..89
AAA_16 [PF13191], Evalue: 4.90E-12, Aligned region: 228..272
AAA_16 [PF13191], Evalue: 4.90E-12, Aligned region: 292..330
AAA_16 [PF13191], Evalue: 4.90E-12, Aligned region: 440..440
AAA_16 [PF13191], Evalue: 4.90E-12, Aligned region: 632..687
AAA_16 [PF13191], Evalue: 4.90E-12, Aligned region: 709..738
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 251..331
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 391..419
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 642..667
AAA_22 [PF13401], Evalue: 2.10E-08, Aligned region: 706..733
AAA_19 [PF13245], Evalue: 8.30E-08, Aligned region: 249..277
AAA_19 [PF13245], Evalue: 8.30E-08, Aligned region: 642..666
Sigma54_activat [PF00158], Evalue: 6.40E-07, Aligned region: 247..270
Sigma54_activat [PF00158], Evalue: 6.40E-07, Aligned region: 615..743
AAA_18 [PF13238], Evalue: 5.80E-06, Aligned region: 251..319
AAA_18 [PF13238], Evalue: 5.80E-06, Aligned region: 645..676
AAA_17 [PF13207], Evalue: 8.40E-06, Aligned region: 252..293
AAA_17 [PF13207], Evalue: 8.40E-06, Aligned region: 644..682
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 251..280
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 644..671
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 251..288
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 642..670
AAA_14 [PF13173], Evalue: 2.90E-05, Aligned region: 251..331
AAA_14 [PF13173], Evalue: 2.90E-05, Aligned region: 643..744
AAA_29 [PF13555], Evalue: 3.60E-05, Aligned region: 243..270
AAA_29 [PF13555], Evalue: 3.60E-05, Aligned region: 642..669
IstB_IS21 [PF01695], Evalue: 5.20E-05, Aligned region: 238..272
IstB_IS21 [PF01695], Evalue: 5.20E-05, Aligned region: 644..664
Zeta_toxin [PF06414], Evalue: 7.40E-05, Aligned region: 251..272
Zeta_toxin [PF06414], Evalue: 7.40E-05, Aligned region: 643..684
Clp_N [PF02861], Evalue: 0.00013, Aligned region: 46..93
Clp_N [PF02861], Evalue: 0.00013, Aligned region: 125..149
RuvB_N [PF05496], Evalue: 0.00053, Aligned region: 250..270
RuvB_N [PF05496], Evalue: 0.00053, Aligned region: 322..331
RuvB_N [PF05496], Evalue: 0.00053, Aligned region: 599..665
RuvB_N [PF05496], Evalue: 0.00053, Aligned region: 713..738
UPF0079 [PF02367], Evalue: 0.0024, Aligned region: 251..272
UPF0079 [PF02367], Evalue: 0.0024, Aligned region: 640..670
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 251..273
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 305..331
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 643..679
CbiA [PF01656], Evalue: 0.0045, Aligned region: 254..301
CbiA [PF01656], Evalue: 0.0045, Aligned region: 645..666
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 252..272
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 645..666
T2SE [PF00437], Evalue: 0.0064, Aligned region: 241..271
T2SE [PF00437], Evalue: 0.0064, Aligned region: 639..714
NTPase_1 [PF03266], Evalue: 0.0075, Aligned region: 251..273
NTPase_1 [PF03266], Evalue: 0.0075, Aligned region: 302..328
NTPase_1 [PF03266], Evalue: 0.0075, Aligned region: 644..666
Protein Sequence: 914 a.a.     [Download]
>gi|295681033|ref|YP_003609607.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1002]
MPRQGHAVSGTNIFTCNIIMSISRHALFGKLGATLFRSIESATAFSKLRGNPYIELVHWLHQLLAQSDGD
LHRIVRHCGISRELLERDLQTALAALPSGASVLTDFSHHVETAIERAWVVATLAFGDGRIRGAWLMAALV
ETPELRRLLLAISPEFGKLAVDGLHDALPGWIADSPEAEDTPYDRSDFSSAVPGEASGVLAASAKGATLA
QFCADLTARARAGEIDPVVGREVEIRTMIDVLLRRRQNNPLLTGDAGVGKTAVVEGLARAIAAGEVPPKL
ADVRLLSLDVGALLAGASMKGEFEARLKSVLEEAAKSPAPVVLFVDEIHTLVGAGGQAGTGDAANLLKPA
LARGTLRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEPSAIDMVRGLARTLASHHGVVVLDEAIRA
AVTLSHRYIPSRQLPDKAISLLDTACARVALSQHAPPRELQRIRERFQAARVEAELLGNEVRIGLGSEAA
LADVNAAIETLEFEERVVEAAWRGQSEVAKALASAREVVSGRAVEGEPESGARDSAASELQTLRELERTL
SNLQAETPFVFPEVGEAIVADIVSDWTGIPVGRMITDEVSAVQMLPATLAARVIGQHDALQQIGERVQTA
RAGLADPRKPLGVFLLAGPSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYG
EGGVLTEAVRRRPYSVVLLDEIEKAHGDVHEMFYQVLDKGYMEDGDGRFIDFRNTTILMTSNVGADLSAS
LCADEVLAPDFEGLRSALSTEFLKAFPAAFLGRVTLVPYRPLGSDSLARIVRLHLDRVVRRMADNNRIAL
SYASEVVDYIVGRCLVHETGARLLIGFIELHVLPRLARQWLDAFAAKSALTHMTIEVTDPAAAPADALVV
RAGR
 
Nucleotide Sequence: 2745 bp     [Download]
>gi|295680425|ref|NC_014119.1|:c694078-691334 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGCCAAGGCAGGGCCACGCCGTTTCCGGAACAAACATCTTTACCTGCAACATCATCATGTCCATTTCAC
GCCACGCGTTGTTCGGCAAGCTCGGCGCGACGCTCTTCAGAAGCATCGAATCCGCTACGGCGTTTTCCAA
GCTGCGCGGCAACCCGTATATCGAATTGGTGCACTGGCTGCACCAGTTGCTCGCGCAGTCCGATGGCGAC
CTGCACCGCATCGTCAGACACTGCGGCATCAGCCGCGAACTGCTCGAGCGGGACCTGCAGACGGCGCTCG
CCGCGCTGCCGTCGGGCGCGAGCGTGCTCACGGATTTTTCGCATCATGTCGAGACGGCAATCGAGCGAGC
GTGGGTCGTCGCGACGCTGGCATTCGGCGACGGCCGGATTCGCGGTGCGTGGCTGATGGCGGCGCTTGTC
GAGACGCCGGAATTGCGGCGCTTGCTGCTGGCCATTTCGCCGGAGTTCGGCAAGCTTGCCGTCGACGGCC
TTCACGATGCGTTGCCGGGCTGGATTGCCGATTCCCCCGAAGCGGAAGACACCCCGTACGACCGGAGCGA
CTTTTCGTCCGCGGTGCCGGGCGAGGCGTCCGGTGTGCTCGCAGCATCGGCGAAGGGCGCGACACTTGCA
CAGTTTTGTGCGGATCTGACCGCACGCGCGCGCGCCGGTGAAATTGATCCGGTGGTTGGCCGCGAAGTCG
AGATTCGCACGATGATCGATGTGCTGTTGCGCCGGCGTCAAAACAACCCGCTTCTGACCGGCGACGCCGG
GGTTGGCAAGACCGCGGTGGTCGAAGGCCTCGCGCGCGCTATCGCGGCCGGCGAAGTTCCACCGAAACTT
GCCGACGTGCGGCTGTTGAGCCTCGACGTCGGTGCGCTGCTTGCCGGCGCGAGCATGAAGGGCGAGTTCG
AGGCCAGGCTGAAGTCGGTACTCGAGGAGGCGGCGAAGTCGCCGGCGCCCGTCGTGCTGTTCGTCGACGA
GATTCACACGCTGGTCGGCGCCGGCGGTCAGGCCGGCACCGGCGACGCGGCAAATCTGCTGAAACCGGCG
CTCGCCCGTGGTACGTTGCGCACGATCGGCGCGACGACGTGGTCCGAGTACAAGCGGCACATCGAGAAGG
ACCCGGCGCTCACGCGGCGCTTTCAGGTGCTGCAGATCGCCGAGCCCGAGGAGCCGTCCGCGATCGATAT
GGTCCGCGGACTCGCGCGCACGCTCGCGAGCCATCATGGCGTCGTGGTTCTCGACGAAGCGATTCGCGCA
GCCGTGACGCTATCGCATCGCTATATTCCGTCGCGTCAGTTGCCGGACAAGGCGATCAGCCTGCTCGACA
CCGCCTGCGCGCGGGTCGCGCTATCGCAGCATGCGCCGCCGCGCGAATTGCAGCGGATTCGCGAGCGGTT
TCAAGCCGCGCGCGTCGAAGCCGAGCTGCTCGGGAACGAGGTGCGCATCGGGCTTGGCAGCGAGGCCGCG
TTGGCCGACGTCAACGCGGCGATCGAAACGCTCGAGTTCGAGGAACGTGTTGTCGAAGCCGCCTGGCGGG
GCCAGTCCGAGGTGGCGAAGGCGCTAGCAAGCGCGCGCGAGGTCGTGAGCGGGCGCGCCGTGGAAGGCGA
ACCTGAGTCCGGCGCGCGCGATAGCGCGGCGAGCGAGCTGCAGACGTTGCGCGAGCTGGAGCGGACGTTA
TCGAACCTGCAGGCGGAGACGCCATTCGTGTTTCCGGAAGTCGGCGAAGCGATCGTCGCCGACATCGTCT
CTGACTGGACCGGTATTCCAGTCGGACGCATGATTACCGACGAAGTCAGCGCCGTTCAGATGCTGCCCGC
CACGCTGGCGGCGCGCGTGATCGGCCAGCACGACGCGTTGCAGCAGATCGGCGAGCGCGTGCAGACGGCG
CGCGCCGGGCTCGCGGACCCGCGCAAGCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCCGGCGTTGGCA
AGACGGAAACCGCGCTCGCATTGGCCGAAGCGCTCTACGGCGGCGAGCAGAATCTGATCACGATCAACAT
GAGCGAGTACCAGGAGGCGCATACGGTCTCGGGACTCAAGGGCGCGCCGCCTGGCTACGTCGGTTACGGC
GAGGGCGGCGTGCTGACCGAAGCGGTGCGCCGGCGTCCGTACTCGGTCGTGCTGCTCGACGAGATTGAAA
AGGCACACGGCGACGTGCACGAAATGTTCTACCAGGTGCTGGACAAGGGTTACATGGAAGACGGCGATGG
TCGCTTCATCGATTTCCGCAATACGACCATCCTGATGACCAGCAACGTCGGCGCCGATCTGAGCGCGAGC
CTATGCGCGGATGAAGTGCTAGCGCCGGATTTTGAAGGTCTGCGTTCCGCGCTTTCGACGGAATTCCTGA
AGGCGTTTCCGGCGGCCTTCCTCGGGCGCGTGACGCTGGTGCCATATCGTCCGCTGGGCTCGGATTCGCT
CGCGCGGATCGTGCGTTTGCATCTCGATCGAGTCGTTCGGCGCATGGCGGACAACAACCGCATCGCGCTG
AGTTATGCGTCGGAGGTGGTGGACTACATTGTCGGTCGCTGCCTCGTGCACGAGACCGGTGCGCGTCTTT
TGATCGGCTTTATCGAACTGCACGTGCTGCCGCGCCTCGCACGGCAGTGGCTCGATGCGTTTGCAGCGAA
AAGCGCGCTCACGCATATGACAATCGAGGTGACCGATCCCGCTGCGGCACCTGCTGACGCGCTGGTGGTC
CGCGCTGGCCGATAA