SecReT6
Protein ID: 295681035
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6238
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]695187..696023 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDD5WLK2
KEGG IDbge:BC1002_6238
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.20E-47, Aligned region: 153..272
Protein Sequence: 278 a.a.     [Download]
>gi|295681035|ref|YP_003609609.1| virulence protein SciE type [Burkholderia sp. CCGE1002]
MRISAAPPNPDTPTLGSLLDAQTYGELKERTIDNVRKHPSNVCERWLLFELLCLDGEWSRALQQLQTWAT
LEPEGTSRAQMYRGLIRSEMFRAEVFAGQRTPGEIEPLPEWVKTLLQANAKLGEGNLAAADELRGAALNA
APATRGESTQIGEFEWLTDSDSRLGPVCELTVAGGYRWVPFDSLKSLTFGPVTALTDLVWRSAVVGLRDA
TVLSGYLPVRYPGSETGPTATRLSRETTWKDVGETGVIALGQKTWSTDKGDVGLLDIGECRFNYDERV
 
Nucleotide Sequence: 837 bp     [Download]
>gi|295680425|ref|NC_014119.1|:695187-696023 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGAGAATATCCGCTGCCCCGCCCAACCCTGACACTCCAACCCTTGGCAGCCTGCTCGACGCGCAGACTT
ACGGCGAACTGAAGGAGCGAACCATCGACAACGTTCGCAAGCATCCGTCGAACGTGTGCGAGCGCTGGCT
GCTGTTCGAGCTGTTGTGCCTTGACGGCGAATGGAGCCGCGCGCTACAGCAGCTGCAGACGTGGGCCACG
CTCGAGCCGGAAGGCACATCTCGCGCCCAGATGTATCGCGGGCTGATTCGCAGCGAGATGTTCCGCGCCG
AGGTGTTCGCGGGTCAGCGCACGCCGGGCGAGATCGAGCCGTTGCCCGAGTGGGTGAAAACGCTGCTGCA
AGCCAACGCCAAGCTCGGCGAGGGCAACCTCGCCGCAGCCGACGAACTGCGCGGCGCCGCGTTGAACGCC
GCGCCGGCCACGCGCGGCGAAAGCACGCAGATCGGCGAATTCGAGTGGCTGACCGATAGCGACAGCCGGC
TGGGGCCCGTGTGTGAGCTGACCGTCGCGGGCGGTTATCGCTGGGTGCCGTTCGACTCGCTGAAATCGCT
GACATTCGGTCCGGTCACCGCGCTGACCGACCTCGTCTGGCGCTCGGCCGTCGTGGGCCTAAGGGACGCG
ACCGTGCTGAGCGGCTATCTGCCGGTGCGCTATCCCGGCTCCGAAACTGGCCCCACTGCCACCCGGCTCT
CGCGCGAAACCACCTGGAAAGACGTTGGGGAAACCGGCGTGATCGCGCTCGGCCAGAAAACCTGGAGCAC
CGACAAGGGCGACGTCGGCCTGCTCGACATCGGCGAATGCCGGTTCAATTACGACGAGCGCGTATGA