SecReT6
Protein ID: 295681036
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6239
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]696020..696538 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD5WLK3
KEGG IDbge:BC1002_6239
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-19, Aligned region: 40..148
Protein Sequence: 172 a.a.     [Download]
>gi|295681036|ref|YP_003609610.1| type VI secretion system lysozyme-like protein [Burkholderia sp. CCGE1002]
MTTSDARHRQAYMPSLIDRLLDDAPARRSERPETYAPNSEGMRRIIQRDLSLLLNTTNLDDELDIARYPM
LAESVVNYGIPALSGSYLASRNWETVEKMVRNAIVRFEPRLIPESLRIRPLDSKNPVRYNQLVFEIHGLM
RWSPYPLEFRIQSAFDIEMNHVTFDPQSGKGN
 
Nucleotide Sequence: 519 bp     [Download]
>gi|295680425|ref|NC_014119.1|:696020-696538 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGACCACGTCAGACGCGCGGCACCGGCAAGCCTATATGCCGTCGCTGATCGACCGTCTGCTCGACGATG
CGCCCGCGCGGCGCAGCGAGCGGCCAGAGACCTATGCACCGAACAGCGAAGGCATGCGCCGCATCATCCA
GCGTGATCTGAGCCTGCTGCTCAACACGACGAATCTGGACGACGAATTGGACATCGCGCGCTACCCGATG
CTAGCCGAGTCGGTCGTCAATTACGGCATTCCCGCGTTGTCCGGTAGCTACCTCGCCAGTCGCAACTGGG
AAACCGTCGAGAAGATGGTACGCAACGCAATCGTGCGCTTCGAGCCGCGTCTGATTCCCGAGTCGTTGCG
CATCCGGCCGCTCGATAGCAAGAACCCGGTGCGCTACAACCAGCTCGTGTTCGAGATTCATGGCCTCATG
CGCTGGTCGCCCTATCCACTGGAATTTCGCATTCAGAGCGCATTCGATATCGAAATGAATCACGTCACGT
TCGACCCGCAATCCGGTAAGGGAAATTGA