SecReT6
Protein ID: 295681037
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6240
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]696540..698420 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDD5WLK4
KEGG IDbge:BC1002_6240
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-211, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|295681037|ref|YP_003609611.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MDPQFLDYYSRELTYMREMAGEFAAQHPKIARRLGMEGIDVADPYVERLIEAFCFMSARTQIKLDAEFPR
FTQRLLEVIYPNYVAPTPAIAVAQLRPSLREGDFTKGLKVPRHSMLRSAIPPGEQTACEFRSSQDVMLWP
IDIVEARLTAVPPDIPDTDRHLLPHMQLHGALRLRLRTTGEVKFNQMTNFDRLPIYIGGDERIASHLFEL
IHAGSVASVVRAYGASRDEGHVVAKTPVDFEGLQAEQCLLPLTWNTFHGHNLLQEYFACRQRFYFFALTQ
LAAGLARVDSTEAEIVLLLDRLPEELAAHVDAARFLLFCTPVVNLFRKRTDRVEINRAQTDFHLLADRTR
PLDYEIFSVSRVFGQRAQTSLEVEFNALYQTLHSDVGNHGRYFSVRREQRALSSNARRYGTRTPYIGTEV
YVSLVDQAEAPYGDDIRYLSVEAWVTNRDLPRLIPRNGKTDLTMSDSVPIEGVRLVHAPSAPRAPYASGE
TAWRLIRQLSFNYMPLAELDHGDGGQALRNMLGLFIAPGEREQARQIEALVGARTEPVVRRLPGDGLLVY
GRGVRCELTVDETGFSGISPYLFGLVLEHYLARHVSINVFTETELRSMQRGLIAQWRPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|295680425|ref|NC_014119.1|:696540-698420 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGGACCCGCAATTTCTCGACTACTACAGCCGCGAACTGACCTACATGCGGGAAATGGCCGGCGAGTTCG
CCGCGCAGCACCCGAAAATCGCACGCCGCCTCGGCATGGAGGGCATCGACGTTGCCGACCCCTATGTGGA
GCGGCTCATCGAGGCATTCTGCTTCATGTCGGCGCGCACGCAGATCAAACTCGACGCCGAGTTTCCGCGC
TTTACGCAGCGCCTGCTCGAAGTGATCTATCCGAATTACGTCGCGCCGACGCCGGCGATCGCCGTCGCGC
AGTTGCGTCCGAGCCTGCGTGAAGGCGATTTCACGAAAGGACTGAAGGTGCCCCGGCATAGCATGCTGCG
CTCGGCGATCCCGCCCGGCGAGCAAACCGCGTGCGAATTCCGCAGCAGCCAGGACGTCATGCTATGGCCT
ATCGACATCGTTGAAGCCCGGCTTACCGCCGTGCCCCCGGATATCCCCGACACCGATCGCCATCTGTTGC
CGCACATGCAATTGCACGGCGCATTGCGGCTGCGCCTGCGCACAACCGGCGAAGTGAAGTTCAACCAGAT
GACGAACTTCGACCGGCTGCCCATTTACATCGGTGGCGACGAACGGATCGCTTCGCATCTGTTCGAGCTG
ATCCATGCCGGTAGCGTCGCTTCGGTCGTGCGCGCGTACGGTGCGTCGAGAGACGAAGGGCACGTGGTCG
CGAAAACACCCGTCGACTTTGAAGGTCTGCAAGCGGAACAGTGCCTGCTGCCGCTTACATGGAATACGTT
TCACGGCCACAACCTGCTGCAGGAATACTTCGCATGCCGCCAGCGCTTCTATTTCTTCGCGCTGACGCAG
CTTGCGGCCGGTCTCGCGCGCGTTGATAGCACGGAAGCCGAGATCGTGCTGCTGCTCGACCGTCTGCCGG
AAGAGCTGGCCGCGCACGTCGATGCAGCGCGCTTCCTGCTGTTCTGTACGCCGGTCGTCAACCTGTTTCG
CAAACGCACTGATCGCGTTGAAATCAATCGCGCGCAAACCGATTTTCATCTGCTCGCCGACCGCACCCGT
CCGCTCGACTATGAGATTTTTTCGGTGTCGCGCGTATTCGGTCAGCGAGCGCAAACATCGCTCGAAGTCG
AATTCAATGCGCTCTATCAGACCCTGCATAGCGACGTGGGCAACCACGGCCGCTATTTCTCGGTGCGTCG
CGAGCAGCGCGCTTTGTCGTCCAACGCACGCAGGTACGGCACCCGTACGCCGTATATCGGCACCGAGGTC
TACGTGTCGCTCGTCGATCAGGCGGAGGCGCCGTACGGTGACGACATCCGCTACCTGTCGGTCGAAGCGT
GGGTCACGAACCGCGACCTGCCGCGCCTGATCCCGCGTAACGGCAAAACCGATCTCACGATGTCCGACTC
CGTGCCGATCGAGGGCGTGCGCCTCGTGCATGCACCGAGCGCGCCGCGCGCGCCTTACGCGAGCGGTGAA
ACGGCGTGGCGTCTGATCCGGCAGCTGAGCTTCAACTACATGCCGCTCGCCGAACTCGACCACGGCGACG
GCGGCCAGGCGTTGCGCAACATGCTCGGCCTTTTCATCGCGCCAGGCGAGCGCGAACAGGCACGGCAAAT
CGAGGCACTGGTCGGTGCACGCACCGAACCGGTGGTGCGGCGTCTGCCAGGCGACGGACTACTCGTCTAT
GGGCGTGGCGTGCGCTGCGAACTGACGGTCGATGAAACCGGCTTCTCAGGCATCAGCCCGTATCTATTCG
GCCTCGTGCTCGAGCACTACCTCGCGCGCCACGTTTCGATCAACGTGTTCACCGAAACCGAACTTCGTTC
GATGCAACGTGGCCTGATCGCCCAATGGCGGCCACGCATGGGCGGACGCGGAGCGGTATGA