SecReT6
Protein ID: 295681038
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6241
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]698423..699490 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDD5WLK5
KEGG IDbge:BC1002_6241
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-96, Aligned region: 28..328
Protein Sequence: 355 a.a.     [Download]
>gi|295681038|ref|YP_003609612.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MEGTFASAVAPTRSSLDPQSLDAWFDPDTPWQSGFLSLLRAIAARDPLMPLPGTASLPHEEPFRIGQQPT
LAFAPREIASLGTRDGRLDVRLFGLGLWGPQGPLPLHMTELAHSRVESHQDHALVGLVDLFHHRALSQFY
RAWASGQATASLDRASDETFSFYVASLIGVEPAEAKQSCLPTHSRYSAAAHLVREARTPHGIAATLSHYF
GVPMTIEEFVPHWIHLSASEHTRLGVPGPAAIIGECAQLGEAIPDRQHKFRLVVGPLDLDQYLRLTPHGE
DLPTFVEWVRAFVGHEYAWEVRLLVNPRAAPAACIGTSQRLGYSTWLGDSVGDLPVVGMVFEPEQYNDRP
RSSFA
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|295680425|ref|NC_014119.1|:698423-699490 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGGAGGGGACTTTTGCGAGCGCCGTCGCGCCGACGCGATCATCGCTCGATCCGCAATCGCTCGACGCGT
GGTTCGATCCCGACACGCCGTGGCAGTCCGGCTTCCTGAGCCTGCTGCGCGCGATCGCCGCGCGTGACCC
GCTGATGCCGTTGCCGGGCACCGCGAGCCTGCCGCACGAAGAGCCGTTCCGGATTGGTCAGCAGCCCACA
CTGGCCTTTGCGCCGCGCGAAATCGCGTCGCTCGGCACGCGAGACGGTCGGCTCGATGTGCGGTTGTTCG
GGCTCGGCCTGTGGGGGCCGCAAGGGCCGCTGCCGCTGCATATGACGGAGCTGGCTCACAGTCGGGTGGA
AAGCCACCAGGATCATGCGCTCGTCGGGCTCGTCGATCTGTTCCATCACCGCGCGCTGTCGCAGTTTTAT
CGCGCGTGGGCATCGGGGCAAGCCACCGCGTCGCTCGACCGTGCCAGCGACGAAACGTTTTCGTTCTACG
TCGCCAGTCTGATCGGCGTCGAGCCGGCCGAGGCGAAGCAGTCCTGCCTGCCCACGCACTCGCGCTATAG
CGCGGCGGCGCACCTCGTGCGGGAGGCGCGAACGCCGCACGGCATCGCGGCGACGCTCTCGCATTACTTC
GGTGTTCCGATGACCATCGAAGAATTCGTGCCGCACTGGATCCACCTGTCCGCATCGGAACATACGAGGC
TGGGGGTGCCGGGGCCCGCGGCGATCATCGGTGAATGCGCGCAGCTTGGCGAGGCCATTCCCGACCGGCA
ACACAAGTTCCGGCTCGTCGTGGGTCCGCTCGACCTCGATCAGTATCTGCGCCTCACGCCGCACGGCGAG
GACTTGCCGACGTTCGTCGAATGGGTGCGGGCCTTCGTCGGCCATGAATACGCGTGGGAGGTCAGGCTGC
TCGTCAACCCACGTGCGGCGCCGGCTGCCTGCATCGGCACGTCGCAGAGACTCGGCTACTCGACATGGCT
CGGTGATTCCGTCGGCGACCTTCCCGTCGTCGGGATGGTTTTCGAACCTGAACAGTACAACGACCGACCC
CGGAGTTCCTTCGCATGA