SecReT6
Protein ID: 295681039
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6242
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]699487..700557 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDD5WLK6
KEGG IDbge:BC1002_6242
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.00E-22, Aligned region: 61..120
Protein Sequence: 356 a.a.     [Download]
>gi|295681039|ref|YP_003609613.1| type VI secretion-associated protein, ImpA family [Burkholderia sp. CCGE1002]
MNANTPTVALRYADLLEPVSAPAPCGPDLEYDPAFVMLQAAAAPRAEAQYGDFVDVPPTANWADIERDCR
ALLLRTKDIRLAVILLRCRTRLDGAAGLRDGLALLMAMFECYGEALHPLPVFEGERDAAMFANAIGGLVE
PDGMLADARDIPMPRAAGLQLHLRDIEKSFATPRQKDALAPESVARLLKELWGRRDAAIAALVEAQCLTQ
RIAVWCDETLGVDAPDLGALSRALQPFAQHRVDGGGASAPTPAPAPAVNEQDNDIARGSAPSSVATATLP
KSDAPADPPITAPSPMDRWSALAAIQETRRWFEQNEPSSPVIVLLRQSERMVGKRFSELAHIIPADLLAK
WDEFDG
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|295680425|ref|NC_014119.1|:699487-700557 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGAACGCCAACACTCCCACCGTCGCGCTGCGCTACGCCGATCTGCTCGAACCGGTGTCGGCGCCCGCGC
CTTGCGGTCCCGATCTCGAATACGACCCGGCTTTCGTGATGCTGCAGGCGGCCGCGGCTCCACGCGCCGA
AGCGCAGTACGGCGACTTCGTCGACGTGCCGCCAACGGCCAATTGGGCCGACATCGAACGCGATTGCCGC
GCGCTGCTGCTGCGGACGAAAGACATCCGCCTCGCGGTGATCCTGCTGCGGTGTCGAACCCGGCTCGACG
GCGCGGCCGGCCTGCGCGATGGCCTGGCTTTGCTAATGGCGATGTTCGAATGCTATGGCGAAGCGCTCCA
CCCGCTGCCCGTGTTCGAAGGCGAACGAGACGCGGCGATGTTCGCCAACGCGATCGGTGGGCTCGTCGAA
CCCGATGGCATGCTGGCCGATGCGCGCGACATACCGATGCCGAGGGCGGCGGGACTGCAACTGCATTTGC
GCGACATCGAAAAATCATTCGCGACGCCGCGCCAGAAGGACGCGCTCGCCCCTGAATCCGTCGCCCGCTT
GCTAAAGGAATTATGGGGCCGACGCGACGCAGCGATTGCCGCATTAGTCGAAGCGCAGTGTCTGACGCAA
CGCATCGCCGTATGGTGCGATGAGACGCTCGGCGTCGACGCGCCCGATCTCGGCGCGTTGTCCCGAGCGC
TGCAGCCATTCGCGCAGCATAGGGTGGACGGCGGCGGCGCGTCCGCGCCAACGCCAGCGCCCGCACCAGC
CGTCAACGAGCAGGACAACGACATCGCGCGTGGATCGGCGCCGTCCAGCGTCGCTACGGCAACGCTACCG
AAGTCCGACGCGCCGGCCGATCCACCAATCACCGCGCCCTCTCCAATGGATCGCTGGAGCGCGCTCGCAG
CCATACAGGAAACACGCAGGTGGTTCGAGCAAAACGAACCGAGCAGTCCCGTCATTGTTTTGCTGCGCCA
GTCGGAACGAATGGTGGGCAAACGGTTTTCAGAACTCGCCCATATCATTCCCGCGGATTTACTCGCTAAA
TGGGATGAGTTCGACGGTTGA