SecReT6
Protein ID: 295681044
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6247
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]706798..709332 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDD5WLL1
KEGG IDbge:BC1002_6247
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-83, Aligned region: 48..370
Phage_base_V [PF04717], Evalue: 4.50E-24, Aligned region: 410..503
Phage_base_V [PF04717], Evalue: 4.50E-24, Aligned region: 682..714
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 554..575
Gp5_C [PF06715], Evalue: 4.60E-06, Aligned region: 620..640
Protein Sequence: 844 a.a.     [Download]
>gi|295681044|ref|YP_003609618.1| ImpA family type VI secretion-associated protein [Burkholderia sp. CCGE1002]
MSSNPLNAISVQRRAVTVSSAAIPRWPAQSADGLTQPALQFMSLEGDESLGKLFEYELLLRTPDDYTVPL
AVSANLDLKALLGKEMTVAIDLEPSADPEAAQREITGLVAAAQYLRREGRYNVYRVVLKPWLWLATLTTD
YKIFQNKTVIEIIDEVLKDYPYPVEKRVDVSRYALDGESPTNEPRAFQVQYGETDYHFIQRLMEEWGIYW
FFEHADGKHRLVLCDHIGAHRQSPNSAYRTLAFQPQNGKTDTEYISAFSTAEVLCTGHYVTSDFDFTRSR
ADMRAINQQPRDTSWNLLERYDWPGDYTDSSHGELLARTRMEELRATGTRAQGKGNVRGLACGQTFVLTH
YDYTAANCEYLVIGTELHLSGTPDESGSGYEYTCSNKFDVQPTSEVFRLPRETSKPIVSGPQSAVVVGPE
GKELWTDEFGRVKVRFAWDRYGRNVETDSCWVRVSQAWAGQGFGGIYIPRIGQEVIVDFWNGDPDRPLIT
GSLYNTVTRPPYALPGNATQSGFMSRSMEGGLQNYNSIRFEDKAGAEEFTVQAERDMNRLTKLNESHVVG
ADYTIGVAAAHSMNVGAASSTVVGGKYSVRVKDVASYSVGLGQFVSIGGLEETAVGGASTLTVGGARTVT
VGGASTHAVGGAYSLSAGGVLSIVCGKSSLTMNKDGEIKLIGKSIRIQGDTRVVVQGTPLDLNPGDMECG
SAVTVPVPVVVLDALDVPIIPPPPSEEPLPTVDPLPTVDPLPTEEPLPSEEPLPSEEPPPSEEPPPSEEP
PPSEEPPPSEEPLPSEEPLPSEEPLPSEEPPPSEEPPPSEEPPPSEEPPPSEEPPPSEEPPPPTETPPVT
GTDA
 
Nucleotide Sequence: 2535 bp     [Download]
>gi|295680425|ref|NC_014119.1|:c709332-706798 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGTCAAGTAATCCCTTGAACGCGATAAGTGTGCAACGCCGCGCAGTGACCGTATCCAGCGCGGCGATAC
CGCGGTGGCCGGCTCAGAGCGCGGACGGACTGACGCAGCCGGCGCTGCAGTTCATGTCTCTGGAGGGCGA
CGAGTCTCTCGGCAAGCTGTTCGAATACGAGCTGCTGTTGCGCACGCCCGACGATTACACGGTGCCGCTT
GCCGTCAGTGCCAACCTCGACCTGAAGGCGCTGCTGGGCAAGGAAATGACCGTCGCGATCGACCTCGAGC
CGAGTGCCGATCCCGAAGCGGCTCAGCGTGAAATCACCGGACTCGTCGCCGCCGCGCAATATCTGCGTCG
GGAAGGCCGCTACAACGTCTATCGTGTCGTGCTGAAGCCCTGGCTGTGGCTGGCCACCCTGACGACCGAC
TACAAGATTTTCCAGAACAAGACGGTCATCGAGATCATCGACGAAGTTCTGAAAGACTATCCGTACCCGG
TCGAAAAGCGCGTCGACGTGAGCCGCTATGCGCTCGACGGTGAGAGTCCGACCAACGAGCCACGCGCGTT
CCAGGTCCAGTACGGCGAGACCGACTATCACTTCATTCAACGTCTGATGGAGGAGTGGGGCATCTACTGG
TTTTTCGAGCATGCCGACGGCAAGCACCGGCTCGTGCTGTGCGATCACATTGGCGCGCACCGTCAGTCGC
CGAACTCCGCATACCGGACGCTCGCGTTCCAGCCGCAGAACGGCAAGACCGACACCGAATACATCAGCGC
ATTTTCGACGGCCGAAGTTTTGTGCACCGGTCACTACGTGACGAGCGACTTCGACTTCACGCGTTCGCGC
GCCGACATGCGAGCGATCAATCAGCAGCCGCGCGACACAAGCTGGAACCTGCTCGAGCGCTACGACTGGC
CGGGCGACTACACCGACAGCAGCCACGGGGAACTGCTCGCGCGTACGCGCATGGAAGAGCTGCGCGCGAC
GGGCACGCGAGCGCAAGGCAAAGGTAACGTGCGTGGACTCGCGTGCGGGCAGACGTTCGTGCTGACCCAC
TACGACTATACGGCCGCGAACTGCGAATACCTGGTGATCGGTACGGAACTGCACCTGAGCGGCACGCCGG
ATGAATCGGGAAGCGGCTACGAGTACACATGCAGCAACAAGTTCGACGTGCAGCCGACAAGCGAAGTGTT
CAGACTGCCACGGGAGACGTCGAAGCCGATCGTCAGCGGGCCTCAGTCGGCTGTCGTCGTGGGGCCAGAG
GGCAAGGAATTGTGGACCGACGAATTCGGACGCGTGAAGGTCCGCTTCGCCTGGGACCGCTACGGCCGCA
ATGTCGAAACCGACTCCTGCTGGGTCCGTGTGAGCCAGGCGTGGGCCGGTCAGGGTTTCGGTGGCATCTA
CATTCCGCGCATCGGCCAGGAAGTCATCGTCGATTTCTGGAACGGCGACCCGGATCGTCCGCTGATCACC
GGGAGCCTGTACAACACGGTCACGCGTCCGCCTTATGCGTTGCCTGGCAACGCGACGCAAAGCGGTTTCA
TGAGCCGGTCGATGGAAGGGGGCTTGCAGAACTACAACAGCATTCGCTTCGAGGACAAAGCGGGTGCCGA
GGAATTCACGGTGCAGGCGGAGCGGGACATGAACCGCCTGACGAAGCTCAACGAATCGCACGTGGTCGGT
GCCGACTACACGATCGGCGTGGCCGCGGCGCACAGCATGAACGTTGGGGCAGCTTCCAGTACGGTCGTTG
GCGGCAAGTATTCGGTGAGGGTGAAGGATGTTGCCTCCTATTCCGTGGGTCTTGGACAGTTCGTCTCGAT
CGGCGGGCTCGAGGAGACTGCGGTCGGGGGTGCCTCGACTCTGACGGTAGGCGGGGCACGTACGGTCACG
GTCGGTGGCGCGTCGACGCACGCGGTAGGCGGGGCCTATTCGCTGTCGGCTGGAGGGGTGTTGTCTATCG
TGTGCGGCAAGTCGTCTCTGACGATGAACAAGGATGGCGAGATCAAGCTCATCGGCAAGTCGATCCGCAT
CCAGGGTGACACCCGTGTCGTGGTGCAAGGCACGCCGCTGGACCTCAACCCCGGTGACATGGAATGCGGT
AGCGCAGTGACAGTGCCGGTTCCGGTAGTGGTGCTTGATGCGCTGGACGTTCCAATTATTCCGCCGCCGC
CTTCGGAGGAACCACTTCCGACGGTAGATCCGCTTCCGACGGTAGATCCGCTTCCGACGGAGGAGCCACT
GCCATCGGAGGAGCCGCTGCCATCGGAAGAACCGCCGCCTTCGGAAGAACCGCCGCCCTCGGAAGAGCCG
CCGCCCTCGGAAGAGCCGCCGCCTTCGGAAGAGCCGCTGCCATCGGAGGAGCCGCTGCCGTCGGAGGAGC
CGCTGCCGTCGGAAGAGCCACCCCCGTCGGAAGAGCCACCGCCGTCGGAAGAGCCACCGCCTTCGGAGGA
GCCACCACCTTCGGAAGAACCGCCTCCGTCGGAAGAACCGCCGCCGCCGACTGAAACACCGCCGGTAACC
GGCACAGACGCGTAA