SecReT6
Protein ID: 295681047
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6250
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]714676..716025 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDD5WLL4
KEGG IDbge:BC1002_6250
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-137, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|295681047|ref|YP_003609621.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MSWYSKVVWSEGLFLRPQLFQQQERYFESFAHRRSAPLSPFFWGFSRYEIDQESLGFGKLVFKSGLGVFP
DGTPFEVPGLTQPPPPLTIGAEHQEQVIYLAIPLRLPNTEETAFTEQSGSLARYHAYDTELRDSNAIGQG
PKPVQLSNLRLRLLPEKELTQSWIGVALTRVKALHADGAVSLHSTDHIPPVTGYGANPLLREWAMQLHGL
ARLRADALAARLSGADGRSGAAAEAADFLLLQVLNRYEPLLEHICQLEETAPVNLYRELALFAGELSTFV
RPQTRRPRPAPGYDHAQLYRSIRPLVEEVHYLLNQVLIRSAQPIALTEQAHGIRTAATLPNELAGYSSLV
LAVGAQMPAELLQQQFLAQTKISHPQRLPELIRSHLPGLTMATLPVPPRQIPFNSGFIYFELSRTGPFWE
QIARHGGLAMHVAGHFPELKLELWGVRQK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|295680425|ref|NC_014119.1|:c716025-714676 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGAGTTGGTATAGCAAAGTTGTTTGGAGCGAAGGACTATTCCTGCGCCCGCAATTGTTTCAGCAGCAGG
AACGGTATTTCGAGTCGTTCGCGCATCGCCGCAGTGCGCCGCTGAGCCCGTTTTTCTGGGGCTTCAGCCG
TTATGAAATCGATCAGGAATCGCTCGGATTCGGCAAGCTGGTATTCAAGAGCGGGCTGGGCGTATTTCCA
GACGGCACGCCGTTCGAGGTGCCGGGTCTGACGCAGCCTCCGCCCCCACTGACGATCGGCGCGGAACATC
AGGAGCAGGTGATCTACCTGGCGATCCCGCTGCGCTTGCCCAATACCGAGGAAACCGCCTTCACCGAGCA
AAGCGGCTCGCTCGCCCGTTACCATGCGTACGACACGGAACTGCGCGACAGCAATGCGATCGGCCAAGGT
CCGAAGCCCGTCCAACTGTCGAATCTGCGCTTGCGGCTGTTGCCCGAGAAAGAGCTGACGCAGTCCTGGA
TCGGTGTTGCGCTGACGCGCGTGAAGGCGCTGCATGCCGACGGCGCCGTGTCGCTGCACAGCACCGACCA
CATTCCGCCCGTGACCGGTTACGGCGCGAATCCATTGCTGCGGGAATGGGCGATGCAACTGCACGGCCTC
GCGCGACTACGTGCCGACGCGCTCGCCGCTCGTCTGTCAGGTGCCGATGGCCGTTCGGGCGCGGCGGCCG
AAGCGGCCGACTTTCTGCTGCTCCAGGTGCTCAATCGCTATGAGCCGCTGCTCGAACATATTTGCCAACT
CGAGGAGACGGCGCCGGTAAACCTGTATCGCGAACTCGCGCTTTTTGCCGGCGAGCTTTCGACCTTCGTG
CGTCCGCAAACGCGTCGTCCGCGGCCGGCTCCAGGCTATGACCACGCGCAGCTCTACCGCAGTATCAGGC
CGCTCGTCGAGGAGGTTCACTATCTGTTGAACCAGGTGTTGATTCGCAGTGCGCAGCCGATTGCACTGAC
GGAGCAGGCGCACGGCATCCGTACGGCCGCCACGTTGCCGAACGAACTTGCAGGCTATTCGAGCCTCGTG
CTCGCGGTGGGCGCGCAGATGCCTGCCGAATTGCTGCAGCAGCAGTTTCTTGCCCAAACGAAGATCAGCC
ATCCGCAGCGCTTGCCGGAATTGATCCGTTCACACCTGCCGGGTTTGACAATGGCGACGCTGCCGGTTCC
TCCGCGCCAGATTCCGTTCAACTCGGGCTTTATCTATTTCGAACTGTCGCGTACCGGACCGTTCTGGGAA
CAGATTGCACGTCACGGAGGGCTTGCCATGCATGTCGCCGGACACTTCCCGGAACTCAAGCTTGAACTGT
GGGGCGTGCGTCAAAAATGA