SecReT6
Protein ID: 295681048
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6251
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]716031..716576 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDD5WLL5
KEGG IDbge:BC1002_6251
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.30E-42, Aligned region: 26..175
Protein Sequence: 181 a.a.     [Download]
>gi|295681048|ref|YP_003609622.1| type VI secretion lipoprotein [Burkholderia sp. CCGE1002]
MVSIFFSRFAIWLRIGGWLALSGASAWLSGCASAPAPVIKERTTLRLQIAANENVNPNEWGTAAPILVRV
YELKSPTAFQTADFFTLQSDDKKILGDDALVVDEFILRPGDTREIVRKSNPVTTAIGVLAGYRDLGKSVW
RAVYRLPVAPDAAWYRMALPDKEQKLTIQLDQRTVSISKSD
 
Nucleotide Sequence: 546 bp     [Download]
>gi|295680425|ref|NC_014119.1|:c716576-716031 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGGTTTCGATCTTTTTTTCCCGCTTCGCGATATGGCTGCGTATCGGGGGCTGGCTAGCCCTGAGTGGGG
CAAGCGCATGGCTGTCCGGGTGCGCTAGCGCGCCGGCTCCTGTTATCAAGGAGCGAACGACCCTCCGGCT
TCAGATCGCGGCAAACGAGAACGTCAACCCGAACGAGTGGGGAACGGCGGCGCCGATCCTCGTGCGGGTT
TACGAACTGAAGTCGCCGACGGCGTTTCAAACCGCCGACTTTTTCACGCTGCAAAGCGACGACAAAAAAA
TCCTTGGCGACGACGCGCTGGTCGTCGACGAATTCATTCTGCGTCCCGGCGACACACGCGAGATCGTCCG
CAAGTCGAACCCCGTCACTACCGCAATTGGCGTGCTGGCCGGCTACCGGGATCTCGGGAAATCAGTCTGG
CGCGCGGTGTACCGGTTGCCAGTCGCGCCCGACGCCGCATGGTACAGGATGGCTCTTCCAGACAAGGAAC
AGAAGCTGACGATCCAGCTTGACCAGCGCACTGTTTCGATTTCAAAGTCAGACTAA