SecReT6
Protein ID: 295681049
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6252
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]716718..717200 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDD5WLL6
KEGG IDbge:BC1002_6252
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-43, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|295681049|ref|YP_003609623.1| type VI secretion system effector [Burkholderia sp. CCGE1002]
MAQDIFLKINGIDGESADASHKDEIDVLSWGWGVTQQSNMHVGSGGGAGRATVEDFTFEHFIDRATPNLT
QYCLTGKHIDEAKLVVRKAGGNPLEYIKFTMHDVLVTSVHPSGVSDSESRPRESVRLSFARLKQEYVVQN
AQGGSGGAITATFDIKKNTA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|295680425|ref|NC_014119.1|:c717200-716718 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGGCGCAAGACATCTTTCTCAAGATTAACGGGATTGATGGTGAGTCGGCGGACGCTAGCCACAAGGACG
AAATCGATGTTCTGAGCTGGGGGTGGGGCGTTACGCAGCAATCGAATATGCACGTTGGTTCCGGCGGCGG
CGCCGGCCGAGCAACGGTCGAAGACTTCACCTTCGAGCATTTCATCGATCGTGCAACGCCCAATCTGACG
CAATACTGCCTGACCGGTAAGCACATCGACGAAGCGAAGCTGGTCGTGCGTAAGGCCGGGGGTAATCCGC
TCGAGTACATCAAATTCACGATGCACGACGTGCTGGTTACCTCGGTGCATCCCTCCGGTGTCAGCGACAG
CGAATCGCGTCCGCGCGAATCAGTGCGTCTGTCCTTTGCTCGTCTGAAGCAGGAGTATGTGGTGCAGAAC
GCGCAAGGCGGTAGCGGTGGTGCGATCACGGCGACCTTCGATATCAAGAAGAACACAGCCTAA