SecReT6
Protein ID: 295681052
SecReT6 ID494
T6SS typeN/A
Gene symbol-
Locus tagBC1002_6256
StrainBurkholderia sp. CCGE1002
Repliconchromosome III [GenBank: NC_014119] [Browse all T6SS(s) in this replicon]
Location [Strand]721280..721966 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDD5WLL9
KEGG IDbge:BC1002_6256
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.60E-29, Aligned region: 5..207
Protein Sequence: 228 a.a.     [Download]
>gi|295681052|ref|YP_003609626.1| DotU family type IV / VI secretion system protein [Burkholderia sp. CCGE1002]
MFDSIVALMRATALHAALLSDGAEMPAIPFWRARCSNLVETLQQQMQDRSFPATDIKEVSLAQCVLLDEL
TLHALPSKQHEEWLRDPLQKRFHGVRDGAALVWERIEAVVNGGGRDLAWLEFYSVLLGLGFDGGRGDTNA
YLKRAKSASNSHRCDTAVLSISDVPDTAMTLSNSIRPSDRSHVPHLRRTVAGFIVGAIAVASLWAVLGLS
RDAAIPGLPQSSSQQSTQ
 
Nucleotide Sequence: 687 bp     [Download]
>gi|295680425|ref|NC_014119.1|:c721966-721280 Burkholderia sp. CCGE1002 chromosome 3, complete sequence
ATGTTTGATTCAATAGTCGCGCTGATGCGTGCGACAGCGTTGCATGCAGCACTGCTATCCGACGGCGCGG
AGATGCCGGCCATTCCTTTTTGGCGCGCGCGTTGTAGCAACTTGGTCGAGACGCTACAGCAACAAATGCA
GGATCGAAGCTTTCCGGCGACCGATATCAAGGAAGTCAGCCTCGCACAGTGCGTTCTGCTAGATGAGCTG
ACGTTGCATGCATTGCCTTCCAAACAGCACGAGGAATGGTTGCGTGACCCGCTGCAGAAGCGTTTTCATG
GCGTGCGCGATGGCGCAGCATTGGTGTGGGAACGGATCGAAGCCGTGGTGAATGGCGGCGGCCGGGATCT
CGCCTGGCTCGAGTTCTACAGCGTGTTGCTGGGGCTGGGCTTCGACGGCGGACGGGGAGACACGAACGCA
TATCTGAAGCGTGCGAAATCGGCGTCGAATTCGCATAGATGTGACACCGCGGTGTTGTCCATATCCGACG
TACCGGATACCGCAATGACATTGTCCAATTCAATTCGGCCGTCGGACAGATCACACGTCCCACATTTACG
CAGGACCGTCGCCGGGTTCATTGTTGGCGCGATTGCCGTCGCGTCACTATGGGCGGTGCTGGGCCTTAGC
CGGGACGCTGCGATACCTGGTCTACCTCAATCATCGTCCCAGCAGAGTACGCAATGA