SecReT6
Protein ID: 295699882
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4277
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1167901..1168422 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDD5WIG9
KEGG IDbge:BC1002_4277
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.70E-37, Aligned region: 14..161
Protein Sequence: 173 a.a.     [Download]
>gi|295699882|ref|YP_003607775.1| type VI secretion lipoprotein [Burkholderia sp. CCGE1002]
MNLRFTVSTIASVALLSACGAWQAVSDASSSAYHAVFFKQIKVLDVDLSAREALNPDDAGRATSVAVRVY
QLKARKMFDGASYEDLLKNDRTVLARDLQASMASVLNPGASASLSQPMQADTEYVAVVAFYRNPGSGDGW
KYVIEKKKLDADKPLKISLMDQFLVTAGTGAHD
 
Nucleotide Sequence: 522 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1168422-1167901 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGAATCTTCGTTTCACCGTTTCCACCATCGCGTCCGTTGCGCTGCTGTCGGCATGCGGCGCATGGCAAG
CGGTGTCGGACGCGTCGTCGAGCGCGTATCACGCGGTGTTCTTCAAGCAGATCAAGGTGCTCGACGTCGA
TCTGTCCGCGCGCGAAGCGCTGAACCCCGACGACGCCGGTCGCGCGACATCGGTTGCGGTGCGCGTGTAT
CAACTGAAGGCCCGCAAGATGTTCGACGGCGCGTCGTACGAGGATCTGCTGAAGAACGACCGCACGGTGC
TCGCGCGGGACCTGCAGGCGAGCATGGCATCGGTGCTGAACCCGGGTGCGTCGGCGAGCCTGTCGCAGCC
GATGCAGGCCGATACGGAATATGTGGCGGTCGTCGCGTTCTATCGCAATCCAGGCAGCGGGGACGGCTGG
AAGTATGTGATCGAGAAGAAGAAGCTCGACGCGGATAAGCCGTTGAAAATCTCGTTGATGGATCAGTTTC
TGGTGACGGCGGGGACCGGGGCCCACGATTGA