SecReT6
Protein ID: 295699883
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4278
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1168449..1169585 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDD5WIH0
KEGG IDbge:BC1002_4278
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.90E-86, Aligned region: 26..347
Protein Sequence: 378 a.a.     [Download]
>gi|295699883|ref|YP_003607776.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MSAYANAFEARDEPRNLEPLVAALLARAPRMNFMQLCRLLELRAPDHAGFGTRDTPAHEPVRFRPRARTG
FPTGEIAAVEFDDDPDAFGGGDAPPTVRTTFMGLYGVDAAMPSHMIDEIVLREEGHEAVEAFLDQFNHRF
VTLLYRAWKKYRYPESFRAGGSDAHSRNLLCLAGFGWGDKPQRAGLPDSRLLALLGLLIQRTRTPEGLAG
VIALAVPGVDVRVDEFFPAPARVGKPQPLTSLATRAGATNDNGARRGLGGGYVLGKRLAYRSRAVRVTLR
PADAAQAHDLLPGAWLHRELMAFVQLYVGVKADVHLHMKISSRLAPLPAIHGGPAGPAPRLGWTTVLPAM
SERLINVGLGVCQAFPKPAANPYLTRSA
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1169585-1168449 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGAGCGCATACGCGAACGCTTTCGAGGCGCGCGACGAACCGCGGAATCTCGAACCGCTCGTCGCGGCGC
TGCTCGCGCGCGCGCCACGGATGAACTTCATGCAGTTGTGCCGACTGCTCGAATTGCGGGCGCCGGACCA
TGCTGGTTTCGGCACTCGTGATACCCCGGCGCACGAGCCGGTACGCTTCCGGCCACGCGCGCGCACCGGC
TTTCCGACGGGCGAGATCGCCGCGGTCGAATTCGACGATGATCCGGATGCCTTCGGCGGCGGCGACGCGC
CGCCGACCGTACGCACGACCTTCATGGGACTCTACGGCGTCGACGCGGCGATGCCGTCGCACATGATCGA
CGAGATCGTGCTGCGCGAGGAAGGGCACGAAGCGGTCGAAGCCTTTCTCGATCAGTTCAATCATCGCTTC
GTGACGCTGCTGTATCGCGCGTGGAAAAAGTACCGCTATCCGGAGAGTTTTCGCGCGGGCGGCAGCGATG
CGCATTCGCGCAATCTGTTGTGCCTCGCCGGCTTCGGCTGGGGCGACAAGCCGCAGCGCGCAGGCTTGCC
CGATTCGCGGCTGCTCGCGCTGCTCGGCCTGTTGATCCAGCGCACGCGCACGCCCGAGGGGCTCGCCGGC
GTGATTGCGCTCGCGGTACCGGGCGTCGATGTACGGGTGGATGAGTTCTTTCCCGCGCCCGCGCGCGTCG
GCAAGCCGCAACCGCTGACGTCGTTGGCCACTCGTGCTGGTGCGACCAACGACAACGGCGCGCGCCGCGG
CCTCGGCGGCGGCTATGTGCTCGGCAAGCGGCTTGCGTATCGCAGCCGGGCGGTGCGCGTGACGTTGCGG
CCGGCCGATGCCGCCCAGGCGCACGATCTGTTGCCGGGTGCGTGGCTGCATCGCGAGTTGATGGCGTTCG
TGCAGTTGTATGTCGGGGTGAAGGCCGACGTGCATCTGCATATGAAAATCTCGTCGCGTCTCGCGCCGCT
GCCCGCGATCCACGGAGGACCGGCCGGACCCGCGCCGCGCCTCGGCTGGACCACCGTGCTGCCTGCCATG
AGCGAACGCCTGATCAACGTCGGGCTCGGGGTTTGTCAAGCGTTTCCGAAGCCCGCGGCCAATCCGTACC
TGACTCGATCCGCGTGA