SecReT6
Protein ID: 295699884
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4279
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1169582..1171396 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDD5WIH1
KEGG IDbge:BC1002_4279
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-178, Aligned region: 8..603
Protein Sequence: 604 a.a.     [Download]
>gi|295699884|ref|YP_003607777.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MEHDDPILRYYEAEMRYLREAGKEFAQAHPDRARMLNLDRVGDRDSYVERLHEGFAFLTGRLQQKLDDEL
PELTEGLVSLLWPHYLRMIPSLSIVELLPLAEKLQRTEFVPAGVPVRSAPIAVPNAAGADGTTLNTVQCL
YRTTQPVTLQPLSITHAGPTVRHDGRSIVRLGFELDQSARRKETDLSRVRLYLSADLPTAFAMHLALTRE
VDAIHWRIPEVRDGEALPLANVTIEPAGFSADERLWPKADAAFSGFQLLLEYFTFREKFLFVDLCGLDVT
KLPDNSTRFELEIVLKHTYPSDQRFSPENVRLFCTPVINLFELDAEPIEIDHHETEYRVLPAGHQGEHVE
TYSVDAIEAFDHDTAERYEYLPFATFRHRGGMLRHEAPERYFHARVRPGVAGLHETWVVLGGHAWETMHT
LPEESLSLRVTGTNGMLPRKGLREARIAELATSTANIAGVHNLVAPTLPLYPPTGDRFQWRVLSHLAPNF
LSMMNAEVLRGALALYDWTSDELNRRRLAGILWVSQELLEELSGGSVERGVHIEVTLDSHAFAGEGDVML
FGELLQRFFALYAEINLFTKLSIVSLPSQTRTDWPRSKAQRAPL
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1171396-1169582 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGAACACGACGACCCGATCCTGCGCTACTACGAAGCCGAAATGCGCTACCTGCGCGAGGCCGGCAAGG
AATTCGCGCAGGCACATCCCGACCGCGCGCGGATGCTGAACCTCGATCGCGTCGGTGATCGCGATTCCTA
CGTCGAGCGCTTGCACGAAGGTTTTGCGTTTCTGACCGGCCGTCTCCAGCAGAAGCTCGACGATGAATTG
CCGGAGTTGACCGAAGGCCTCGTGAGTCTGCTGTGGCCGCACTATCTGCGGATGATTCCGTCGCTGTCGA
TCGTCGAACTGTTGCCGCTCGCGGAGAAGCTGCAGCGAACCGAGTTCGTGCCGGCCGGCGTGCCGGTCCG
CTCGGCGCCGATCGCGGTGCCGAACGCGGCGGGCGCCGATGGCACGACGCTGAACACCGTGCAATGTCTG
TACCGGACCACGCAGCCAGTCACGCTGCAGCCGCTGTCGATTACACACGCGGGTCCCACTGTGCGCCACG
ACGGCCGCTCGATCGTCCGGCTCGGCTTCGAGCTCGATCAGTCCGCGCGTCGGAAGGAAACGGACCTGTC
GCGCGTGCGGCTGTATCTGAGTGCCGATCTGCCGACCGCGTTCGCGATGCATCTGGCGCTCACGCGCGAG
GTCGATGCGATCCACTGGCGCATTCCGGAAGTGCGCGATGGCGAAGCGCTGCCGCTCGCCAACGTGACGA
TCGAGCCGGCTGGGTTCTCCGCCGACGAGAGGCTGTGGCCGAAGGCCGACGCGGCGTTTTCCGGCTTTCA
GCTGCTACTCGAATACTTCACGTTCCGCGAGAAATTCCTGTTCGTCGATCTTTGCGGACTCGACGTGACG
AAGCTGCCGGATAATTCGACACGCTTCGAACTGGAGATCGTTCTGAAGCACACGTATCCGTCAGATCAGC
GTTTCAGTCCGGAAAACGTGCGGCTCTTCTGCACTCCGGTGATCAACCTGTTCGAACTCGACGCCGAGCC
GATCGAGATCGATCATCACGAAACCGAATACCGAGTGTTGCCCGCTGGCCATCAGGGCGAGCACGTCGAG
ACCTATTCGGTGGATGCGATCGAGGCGTTCGACCACGACACCGCCGAGCGCTACGAGTACCTGCCGTTCG
CGACGTTCCGGCATCGCGGCGGCATGCTGCGGCACGAGGCGCCCGAGCGCTACTTCCACGCGCGCGTGCG
GCCCGGCGTCGCGGGTTTGCACGAGACATGGGTCGTGCTCGGCGGTCACGCGTGGGAGACGATGCACACG
CTGCCCGAGGAAAGCCTGTCGCTGCGCGTCACCGGCACGAACGGCATGCTGCCGCGCAAGGGCCTGCGCG
AAGCGCGCATCGCCGAGCTTGCGACCAGCACGGCGAACATCGCCGGGGTGCACAATCTCGTCGCGCCGAC
GCTGCCGCTCTATCCACCGACCGGCGACCGCTTCCAGTGGCGGGTGCTATCGCATCTCGCGCCGAACTTC
CTGTCGATGATGAACGCGGAAGTGCTGCGCGGCGCGCTCGCGCTATACGACTGGACCAGCGACGAACTGA
ACCGCCGGCGCCTCGCGGGCATTCTGTGGGTGTCGCAGGAGTTGCTCGAGGAGTTGTCGGGCGGCTCGGT
CGAGCGCGGCGTGCATATCGAGGTGACGCTCGATTCGCACGCGTTCGCGGGCGAGGGCGACGTGATGCTG
TTCGGCGAATTGCTGCAACGCTTTTTCGCGCTGTATGCGGAGATCAATCTGTTTACGAAGCTATCGATCG
TGAGCCTGCCGTCGCAGACCCGCACCGACTGGCCGCGCAGCAAGGCGCAACGGGCTCCGTTATGA