SecReT6
Protein ID: 295699885
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4280
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1171411..1172997 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDD5WIH2
KEGG IDbge:BC1002_4280
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-19, Aligned region: 65..123
ImpA-rel_N [PF06812], Evalue: 2.20E-19, Aligned region: 154..178
ImpA-rel_N [PF06812], Evalue: 2.20E-19, Aligned region: 401..415
Protein Sequence: 528 a.a.     [Download]
>gi|295699885|ref|YP_003607778.1| type VI secretion-associated protein [Burkholderia sp. CCGE1002]
MLASLLKTLFPSRDEEQRVRARLDTWSAWLQPLPGEQGCGRDPGYEDLFFELREETQKLSGIDDSLVVRS
CEQLLKETGKDLRLAGYYAFARLRADGPLGFADGLELAASLVERFGENVLPARAEAKKGALDMLATTRVI
ELLDSRGEFATADLERAIAALDLLVTRTATWTDAARPNLAALIARFEQNEASSRGNELEAATLPVSSGQA
FAGSVNVSIASTRDLLDQARSMGLWLRDQENGYLSSVRLVRTVRWDTLHEVPPVDATSRTRLMPPRGELR
QQMKRLVLQKQWHELLERVEGAFLEGVNHLWFDLQYFQHVALDHVGAPYSAWRDQLRADFALFLERLPGI
ERLAFNDGTPFADDASLEWIARHAVVRNLDAGESIAPLPVAAGSDDEATGDWPEIEAQARDLAERDGIEA
AFAWLDALPGLRTDRQRYLQRLVMARLADRAGRADTALGLLTELDTTARSLPLTRWEPALVFEVKQQLLR
TLKALSNRKDADKPALARRIGELQAELTVLDPARALTF
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1172997-1171411 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGCTGGCGAGTCTGTTGAAGACGCTGTTCCCGTCGCGCGACGAAGAACAACGCGTACGCGCGCGTCTCG
ACACGTGGAGCGCATGGCTGCAGCCGCTACCCGGCGAGCAGGGCTGCGGCCGCGACCCGGGCTATGAGGA
CCTGTTCTTCGAGTTGCGCGAGGAAACGCAAAAACTCTCCGGCATCGACGACAGCCTGGTCGTCCGTTCG
TGCGAGCAGTTGCTGAAGGAGACCGGCAAGGATCTGCGTCTCGCCGGTTACTACGCGTTTGCGCGTCTGC
GTGCGGACGGTCCTCTCGGTTTCGCGGACGGGCTTGAACTCGCGGCGTCGCTCGTCGAGCGCTTCGGCGA
GAACGTGCTGCCAGCGCGCGCCGAGGCGAAGAAGGGCGCGCTCGACATGCTTGCCACCACACGCGTCATC
GAGCTGCTCGACAGTCGCGGCGAGTTCGCGACGGCCGACCTCGAACGCGCGATCGCCGCGCTCGATCTGC
TCGTCACGCGTACCGCCACGTGGACCGACGCGGCTCGGCCGAATCTCGCCGCGCTCATCGCGCGTTTCGA
GCAGAACGAAGCATCGTCGCGCGGTAATGAACTCGAAGCGGCAACGTTACCCGTATCGTCGGGCCAAGCT
TTTGCAGGCAGCGTGAACGTATCGATCGCATCGACCCGCGACCTGCTCGATCAGGCCCGCTCGATGGGGT
TGTGGCTACGCGACCAGGAGAACGGCTATCTATCGTCTGTGCGGCTGGTCCGCACCGTTCGCTGGGACAC
GCTGCACGAAGTGCCGCCCGTCGACGCGACATCACGCACACGTCTGATGCCACCGCGTGGCGAGCTGCGT
CAGCAGATGAAGCGGCTCGTGCTGCAAAAGCAGTGGCATGAGCTGCTCGAACGCGTCGAGGGCGCATTCC
TCGAGGGCGTCAATCACCTGTGGTTCGATCTGCAGTATTTCCAGCATGTCGCACTCGATCACGTCGGCGC
GCCCTACAGCGCATGGCGTGACCAGTTGCGCGCGGATTTCGCGCTGTTTCTCGAACGCTTGCCTGGCATC
GAGCGCCTGGCGTTCAACGACGGCACGCCGTTCGCCGACGACGCATCGCTCGAATGGATCGCACGCCACG
CGGTAGTGCGCAATCTCGACGCGGGCGAGAGTATCGCGCCGCTGCCGGTAGCGGCCGGCAGCGACGACGA
GGCGACCGGCGACTGGCCCGAGATCGAAGCGCAGGCGCGCGACCTCGCGGAACGGGACGGCATCGAGGCG
GCATTCGCCTGGCTCGATGCGTTGCCCGGCCTTCGCACCGATCGGCAGCGCTACCTGCAGCGGCTGGTGA
TGGCGCGCCTCGCCGATCGCGCGGGTCGCGCGGACACGGCGCTCGGACTGCTCACCGAACTCGACACGAC
CGCACGCTCGCTGCCACTCACGCGCTGGGAACCCGCGCTGGTCTTCGAGGTGAAGCAGCAGTTGTTGCGA
ACGCTGAAGGCGCTGAGCAACCGTAAGGACGCCGACAAACCCGCGCTCGCGCGCCGCATCGGCGAACTGC
AAGCCGAGCTGACCGTGCTGGACCCGGCGCGAGCGTTGACCTTCTGA