SecReT6
Protein ID: 295699889
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4286
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1182172..1184508 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDD5WIH6
KEGG IDbge:BC1002_4286
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-52, Aligned region: 32..349
Phage_GPD [PF05954], Evalue: 1.00E-52, Aligned region: 532..586
DUF2345 [PF10106], Evalue: 2.00E-41, Aligned region: 603..751
T6SS_Vgr [PF13296], Evalue: 3.00E-29, Aligned region: 335..355
T6SS_Vgr [PF13296], Evalue: 3.00E-29, Aligned region: 480..585
T6SS_Vgr [PF13296], Evalue: 3.00E-29, Aligned region: 620..642
Phage_base_V [PF04717], Evalue: 2.90E-11, Aligned region: 108..124
Phage_base_V [PF04717], Evalue: 2.90E-11, Aligned region: 415..474
Protein Sequence: 778 a.a.     [Download]
>gi|295699889|ref|YP_003607782.1| Rhs element Vgr protein [Burkholderia sp. CCGE1002]
MSMVSPLQAYELKLAPHPAPFSVLKFAGVDQVSQLYKYEIEFTSPVAGIPMDQVLGRPARFAIEPGDPDI
DYLRKMFGENAGQFSARPPAHTIHGIVTQFDEFDTSVDETRYRVVLEPKLADLDRGVTSRLFQKQSVEEI
ITDTLRHYGYRSGVDFVFQLRGQYKRYEYVTQYHETTFRFIQRLCAREGMWFRWEQKKDRAMIVFGDDLD
AYARKQRTLSLRRDSGLESVGADAITSLERRTRRVTEAVRLHDYNHRHAGVSLLVEENTVRGDSTTNGVD
YHWGEHYETPEEGQRIARLRHEAHLAGQVAFTGTGNPFWLEAGEVMSIHPKTADARHGIFVTSVKSRGAR
DQAYQVTFEGIPSDRVWRTSMTSISRPAIDGILPARVTSPGNYKYAYLTEQGWYVIVLPFDLDQWSPGGT
SRPVRFAKPYSGDGYGHHFPLIDGAEVAIVFTAGDPDRPVIIGAMHDSLHPDLVNNLNNTRNIVRTAAQN
ELRMEDKEGVEHIHLATPFQTSELNLGHMVDGERRERGHGAELRTDGYLSARAAKGVLLSAEVQPGATGE
QITMPNADATLQQAEQVLRSLNDSARAAHALLADVDQQRSLVEQKIAKLRKPVIVASAPEGIGLVSGEHM
QLAAAKQIFVTAGEGIDFGVLKRITAAAGEAISLFAAKLGIRLFAAKGKVQIQAQGDALELMALTNVAVS
SSTGEVIITGSKGITLGDGAGAYLKIANGKIEIASPGEVQVKGSLDVEGPAQGNFTFPRWPGAPLQDVEG
NLNFGFSE
 
Nucleotide Sequence: 2337 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1184508-1182172 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGTCGATGGTATCGCCGTTGCAGGCTTATGAATTGAAGCTGGCGCCGCACCCGGCGCCGTTCTCCGTCT
TGAAATTCGCTGGTGTCGATCAGGTCAGCCAGTTGTACAAGTACGAGATCGAATTCACAAGCCCGGTAGC
TGGAATTCCGATGGATCAGGTGCTGGGACGTCCGGCGCGGTTCGCCATAGAACCGGGAGATCCTGATATC
GATTATCTGCGCAAGATGTTTGGCGAGAACGCCGGACAGTTCAGCGCGAGGCCACCCGCGCACACGATTC
ACGGCATCGTGACGCAGTTCGACGAGTTCGACACGTCGGTTGATGAAACGCGCTATCGGGTCGTGCTGGA
ACCGAAACTCGCCGACCTCGATCGCGGTGTGACGAGCCGGCTGTTTCAGAAACAGTCGGTCGAGGAAATC
ATTACCGATACGCTACGACACTACGGGTATCGCAGCGGGGTCGACTTCGTGTTTCAGTTGCGTGGGCAGT
ACAAGCGGTATGAGTACGTCACGCAGTATCACGAGACGACCTTCAGATTTATTCAGAGGCTCTGCGCGCG
GGAGGGGATGTGGTTCCGGTGGGAGCAGAAGAAAGACCGCGCGATGATCGTGTTCGGCGACGATCTCGAT
GCATACGCACGCAAGCAGCGAACGTTGTCGTTGCGGCGCGATTCGGGGCTCGAGAGTGTGGGCGCGGATG
CGATCACCTCGCTCGAACGGCGAACGCGGCGTGTGACCGAAGCGGTGCGGCTGCATGACTATAACCATCG
CCACGCCGGTGTGTCGTTGCTCGTCGAGGAAAACACTGTACGCGGCGACAGCACCACGAATGGGGTCGAC
TACCACTGGGGCGAGCACTACGAAACACCTGAAGAGGGGCAGCGAATTGCCCGGTTGCGGCATGAGGCGC
ATCTGGCAGGTCAGGTTGCTTTTACTGGCACGGGGAATCCGTTCTGGCTCGAGGCGGGTGAGGTCATGTC
GATCCATCCGAAAACAGCCGATGCGAGGCACGGAATCTTCGTGACTTCAGTGAAGTCACGCGGCGCTCGG
GATCAAGCGTATCAGGTGACATTCGAGGGAATCCCGTCCGATCGAGTGTGGCGGACTTCGATGACGTCGA
TTTCCCGGCCTGCCATCGATGGGATCTTGCCGGCGCGGGTTACGTCACCCGGCAACTATAAGTATGCGTA
TCTGACCGAGCAGGGTTGGTATGTGATCGTGCTGCCGTTCGATCTCGACCAGTGGAGTCCGGGTGGAACG
AGCCGGCCGGTGCGGTTCGCGAAGCCATATAGCGGAGATGGTTACGGGCATCACTTTCCGTTGATCGATG
GGGCGGAAGTGGCGATCGTGTTTACCGCTGGGGATCCGGACCGGCCGGTGATCATCGGGGCGATGCACGA
CAGTTTGCATCCGGATCTCGTCAATAACCTCAACAACACTCGCAATATCGTTCGGACAGCTGCGCAGAAT
GAGTTGCGGATGGAGGATAAGGAAGGGGTCGAGCATATCCATCTGGCTACGCCGTTTCAGACTAGTGAGC
TCAATCTGGGGCATATGGTTGATGGGGAGAGGAGGGAGCGGGGTCACGGCGCCGAACTGAGGACAGATGG
GTATCTGTCAGCCCGGGCGGCCAAAGGCGTGTTGCTTAGCGCCGAAGTACAGCCCGGTGCTACGGGCGAG
CAGATCACGATGCCTAACGCGGACGCAACGCTCCAGCAAGCGGAGCAAGTCCTGCGCTCTCTCAATGATT
CAGCAAGAGCCGCGCACGCGTTGCTGGCCGACGTCGATCAGCAACGTTCGCTCGTCGAGCAGAAGATCGC
AAAACTACGGAAGCCGGTGATCGTGGCGAGCGCACCTGAAGGCATCGGTCTGGTGAGTGGCGAGCACATG
CAGTTGGCCGCGGCTAAGCAAATATTCGTTACAGCAGGTGAAGGAATCGACTTTGGCGTGCTCAAGAGGA
TCACAGCGGCGGCGGGGGAGGCGATTTCGCTGTTTGCCGCGAAGCTTGGCATCCGGTTGTTCGCGGCAAA
AGGAAAAGTCCAGATTCAAGCTCAGGGTGATGCGCTCGAATTGATGGCACTTACCAACGTGGCTGTCAGC
TCGTCAACAGGCGAAGTGATCATTACTGGGTCGAAGGGCATCACGCTGGGTGATGGGGCAGGCGCGTATC
TAAAGATAGCCAACGGGAAGATCGAGATAGCGAGCCCAGGGGAAGTCCAGGTCAAGGGTAGTCTGGATGT
CGAAGGCCCCGCGCAGGGCAATTTCACCTTTCCGCGCTGGCCTGGTGCTCCCCTTCAAGACGTCGAGGGA
AACTTGAATTTCGGGTTTTCTGAATAA