SecReT6
Protein ID: 295699890
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4287
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1184595..1186166 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDD5WIH7
KEGG IDbge:BC1002_4287
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-176, Aligned region: 95..514
Protein Sequence: 523 a.a.     [Download]
>gi|295699890|ref|YP_003607783.1| type VI secretion protein EvpB [Burkholderia sp. CCGE1002]
MEQNESRQGATGTVVLDAAQDASFASDSVYASLCNKINLKPVLEARPLEAFRDNDMLSEASADERIARGI
GAFLELVAQSSQPVERLDKSLLDFHIGQLDRQISRQLDAVLHSPEFQALEGRWRGLKMLVSRTDFRKYAR
IEVLDVSKDALQRDFEDTPELIQSGLYRLTYIEEYDTPGGQPISALISDFEFANSPQDVALLRNISKVAA
AAHMPFIGSVGAAFFGKKSMEEVAAIQDIGNYFDRAEYIKWKSFRDTDDARYVGLTMPRVLGRLPYGKDT
TPVRAFNYEEAVKGPDHDRYLWVNASFAFAANMTRSFVNNGWCVQIRGPQAGGKVEDLPVHLYDLGTGVQ
PKIPTEVLIPETREFEFANLGFIPLSFYKNHDFACFFSANSTQKPALYETKEATANSRINARLPYIFLLS
RIAHYLKLIQRENIGTTKDRRLLEIELNNWIKGLVTEMKDPGDELQASHPLREAKVTVEDIDDNPGFFRI
KLFIIPHFQVEGMDIGLSLVSQMPKAKNRAGVF
 
Nucleotide Sequence: 1572 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1186166-1184595 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGAACAGAATGAATCGCGCCAGGGCGCGACCGGGACCGTTGTGCTTGATGCCGCTCAGGACGCGTCCT
TCGCCAGCGACAGCGTCTACGCGTCGCTGTGCAACAAGATTAACCTGAAACCCGTTTTAGAGGCGCGCCC
GCTCGAGGCGTTCCGCGACAACGACATGCTGTCCGAGGCGTCGGCCGACGAGCGCATCGCGCGCGGCATC
GGCGCGTTTCTCGAGCTGGTTGCGCAATCGAGCCAGCCGGTCGAGCGCCTCGACAAATCGCTGCTCGATT
TTCATATCGGCCAGCTCGATCGTCAGATCAGCCGCCAGCTCGATGCTGTGTTGCACTCGCCCGAGTTCCA
GGCGCTCGAAGGCCGCTGGCGTGGTTTGAAGATGCTGGTGTCGCGCACGGATTTCCGCAAGTACGCGCGT
ATCGAGGTGCTCGATGTGTCGAAAGATGCACTGCAACGCGACTTCGAAGACACGCCTGAGCTGATCCAGA
GCGGCCTGTATCGCCTCACGTACATCGAGGAATACGACACCCCGGGCGGCCAGCCGATCAGCGCGCTGAT
CAGTGACTTCGAGTTTGCGAATTCGCCGCAGGACGTGGCGTTGTTGCGCAATATCTCGAAGGTCGCGGCG
GCGGCGCACATGCCGTTCATCGGCTCGGTCGGCGCGGCGTTCTTCGGCAAGAAGTCGATGGAAGAAGTTG
CGGCGATTCAGGATATCGGCAACTACTTCGATCGTGCCGAGTACATCAAGTGGAAGAGCTTCCGCGATAC
GGACGACGCCCGCTACGTCGGCTTGACGATGCCGCGCGTGCTCGGTCGTCTGCCCTACGGCAAAGACACG
ACGCCAGTGCGCGCGTTCAACTACGAGGAAGCGGTAAAGGGCCCGGACCACGACCGCTATCTGTGGGTGA
ACGCGTCGTTCGCGTTTGCGGCGAACATGACTCGCAGCTTCGTGAACAACGGCTGGTGCGTGCAGATTCG
TGGTCCGCAGGCGGGCGGCAAAGTCGAGGATCTGCCGGTCCACCTGTATGACCTCGGCACTGGCGTGCAG
CCGAAAATCCCGACCGAGGTCCTGATTCCGGAAACGCGTGAGTTCGAGTTTGCGAATCTCGGCTTTATTC
CGTTGTCGTTCTACAAGAACCACGACTTCGCGTGTTTCTTCTCGGCGAATTCAACGCAGAAGCCGGCGCT
GTATGAGACTAAGGAAGCGACTGCCAATAGCCGCATCAACGCGCGGTTGCCGTACATCTTCCTGCTATCG
CGCATCGCACACTACCTGAAGCTGATCCAGCGAGAGAACATTGGGACGACCAAGGATCGACGTCTGCTGG
AAATCGAGCTCAACAACTGGATCAAGGGTCTCGTGACCGAGATGAAGGATCCGGGTGATGAGCTGCAGGC
GTCGCACCCGCTTCGTGAAGCGAAGGTGACGGTCGAAGACATCGACGACAACCCGGGCTTCTTCCGCATC
AAGCTCTTCATCATTCCGCACTTCCAGGTCGAGGGTATGGATATCGGTCTGTCACTGGTGTCGCAGATGC
CGAAGGCGAAGAACCGAGCGGGAGTCTTTTAG