SecReT6
Protein ID: 295699891
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4288
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1186241..1186753 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDD5WIH8
KEGG IDbge:BC1002_4288
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.10E-54, Aligned region: 5..157
Protein Sequence: 170 a.a.     [Download]
>gi|295699891|ref|YP_003607784.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MDSFQREIPKSRVSITLDLHTGGAQKKVELPLKLLVAGDFSAGREQAPLAERTKVNIDRNNFDAVLADHA
PDLKIAAENTLAGDGSELPVKLAFRSMKDFEPEQVARQIPELQALLAMRNLLRDLKSNLLDNGTFRREFE
KVLKDKRLSDRLRGELAQIATAATQPEGHA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|295698848|ref|NC_014118.1|:c1186753-1186241 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGACAGCTTTCAGCGCGAAATACCGAAGAGTCGCGTCTCAATCACGTTGGACCTGCACACGGGCGGCG
CCCAGAAGAAGGTCGAGCTGCCTCTGAAGCTGCTGGTCGCCGGTGATTTCAGCGCGGGCCGCGAGCAGGC
GCCGCTGGCCGAGCGTACGAAGGTCAACATCGACAGGAACAACTTCGACGCCGTGTTGGCCGATCACGCC
CCGGACCTGAAGATCGCCGCCGAGAACACGCTCGCCGGCGACGGTTCAGAGTTGCCTGTCAAGCTCGCGT
TCCGCTCGATGAAGGACTTCGAGCCGGAGCAGGTGGCGCGTCAGATTCCCGAGTTGCAGGCGCTCCTGGC
GATGCGCAATCTGCTACGCGACCTGAAGTCGAATCTGCTCGACAACGGCACGTTCCGCCGCGAGTTCGAA
AAGGTCCTGAAGGACAAGCGTCTGTCGGACAGGCTGCGCGGCGAGCTCGCGCAGATCGCGACGGCCGCGA
CCCAGCCGGAAGGCCATGCCTGA