SecReT6
Protein ID: 295699892
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4289
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1187362..1188714 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDD5WIH9
KEGG IDbge:BC1002_4289
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-124, Aligned region: 18..448
Protein Sequence: 450 a.a.     [Download]
>gi|295699892|ref|YP_003607785.1| type VI secretion protein [Burkholderia sp. CCGE1002]
MRIDKPLWHEGLILTQQHFQQQERWAGFALQQFATCALAEPWGTLGVEVDEEALATGRLKLTRLKLRFAD
GTPIDTTLSDALPAARDLTKGMPADLQSVVVLAALALPDANGNNCRFDETSLARPRRAYREFVKVVDLNG
GSETEIASERHAVRLLFDFESHADDTVCAIARLTRTTTSGQFQVDHRFVPPCLTLGSHPLHLERINRLAD
ILQAKSVVLGARRNERLEQVAEYGVADVQLFWLLHCIHAAWPQLRLYATHPRRSPEQLYTTLAQLVCALM
TFSTRAQLTDIPAYDHARADEVFTKLEATIRELLDAVIPSRVVSIGLTRKSATTWAGQFLEERIVEGAAD
WYLSVSAPMPAFELAEQFPRLCKIGAPDDVEHIINSALLGIPLKAVARVPAAIPVRLDNQYFALDAANAA
HAKMLAARACQIYLPATVPDASLELYAVLR
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|295698848|ref|NC_014118.1|:1187362-1188714 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGCGGATCGACAAACCGCTCTGGCACGAGGGCCTCATCCTCACGCAGCAGCACTTCCAGCAGCAGGAAC
GCTGGGCCGGTTTCGCGCTACAGCAGTTCGCTACCTGCGCGCTCGCCGAGCCGTGGGGCACACTCGGCGT
CGAGGTCGACGAAGAAGCATTGGCAACGGGCCGTCTGAAGCTCACGAGGCTCAAGTTGCGCTTCGCGGAC
GGCACGCCGATCGACACCACGCTGAGCGACGCTCTGCCCGCTGCGCGCGATCTGACAAAAGGCATGCCCG
CCGACCTGCAAAGTGTCGTCGTGCTGGCCGCCCTCGCGTTGCCGGATGCGAACGGCAATAACTGCCGGTT
CGACGAAACGTCGCTTGCGCGTCCCCGCCGCGCATATCGCGAGTTCGTCAAGGTCGTCGATCTGAACGGC
GGCAGCGAAACCGAGATCGCGTCCGAGCGCCACGCAGTGCGCTTGCTGTTCGACTTCGAATCGCATGCCG
ACGACACGGTCTGCGCGATCGCACGGCTCACGCGCACCACCACCAGCGGCCAGTTCCAGGTCGATCACCG
CTTCGTGCCGCCGTGCCTGACGCTGGGGAGTCACCCTCTGCATCTCGAACGCATTAATCGTCTAGCCGAT
ATCCTGCAGGCGAAGAGCGTCGTGCTCGGCGCGCGTCGCAACGAACGGCTCGAGCAGGTCGCCGAATATG
GTGTCGCCGACGTGCAGTTGTTCTGGCTCTTGCACTGCATTCACGCGGCGTGGCCTCAATTGCGGCTCTA
TGCGACGCATCCGCGCCGCTCGCCCGAGCAGCTGTACACGACGCTTGCGCAACTCGTCTGCGCATTGATG
ACGTTCTCGACGCGCGCGCAGCTTACCGACATTCCCGCCTACGATCACGCGCGCGCCGACGAGGTGTTCA
CGAAGCTCGAGGCCACGATCCGCGAATTGCTCGACGCGGTCATTCCGTCGCGCGTCGTGTCGATCGGCCT
CACGCGCAAGAGTGCGACCACGTGGGCGGGTCAGTTCCTCGAAGAGCGCATCGTCGAAGGCGCGGCCGAC
TGGTATCTGTCGGTCAGCGCGCCTATGCCGGCGTTCGAACTCGCCGAGCAGTTCCCGCGCCTGTGCAAGA
TCGGCGCGCCCGACGACGTCGAGCACATCATCAATTCGGCGCTGCTCGGCATTCCGCTCAAGGCGGTAGC
GCGCGTGCCGGCCGCGATTCCGGTGCGCCTCGACAATCAATACTTTGCGCTCGACGCAGCGAATGCCGCG
CACGCGAAGATGCTCGCCGCGCGCGCTTGCCAGATTTATCTGCCGGCGACGGTGCCCGACGCATCGCTCG
AACTTTACGCGGTACTACGCTGA