SecReT6
Protein ID: 295699893
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4290
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1188714..1189445 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDD5WII0
KEGG IDbge:BC1002_4290
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-44, Aligned region: 28..228
Protein Sequence: 243 a.a.     [Download]
>gi|295699893|ref|YP_003607786.1| DotU family type IV / VI secretion system protein [Burkholderia sp. CCGE1002]
MNALPRNSTEAALLDSMAGAPRVTRAGIRDLLRDTALLVTTLTPGGHVDHATDFRNRCGLLIANFSTELE
RRGYADEIRREALLAQCGLLDEVALRYLPAESRAAWELKPLQVELFNLHDAGERVFERLEARMHEASPHV
DLLECYAAILSLGFIGRFARDGEAERAALTTSLHAQLQKLRPAPASTFIADRSDRRLSDWFYRLSPWAIA
GLACGVAAIVWLVWSTALDAQLAQLVQTKVTRP
 
Nucleotide Sequence: 732 bp     [Download]
>gi|295698848|ref|NC_014118.1|:1188714-1189445 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGAACGCGCTGCCCCGAAATTCCACTGAAGCGGCGTTGCTCGATAGCATGGCGGGCGCGCCCCGGGTCA
CGCGTGCAGGCATTCGCGATCTGCTGCGAGACACCGCGCTGCTCGTCACGACGCTCACGCCCGGCGGCCA
CGTGGATCATGCAACCGACTTCCGCAATCGTTGCGGATTGCTGATCGCGAACTTCTCGACGGAACTCGAG
CGGCGCGGCTATGCGGACGAAATACGCCGCGAAGCGCTGCTCGCGCAATGCGGGCTGCTCGATGAAGTCG
CGCTGCGCTATCTGCCGGCAGAGAGCCGAGCGGCGTGGGAACTCAAACCGCTGCAAGTCGAGCTGTTCAA
CCTGCATGACGCCGGCGAGCGTGTGTTCGAACGGCTCGAGGCTCGCATGCATGAAGCGTCGCCGCACGTC
GACCTGCTCGAATGCTATGCGGCGATTCTGAGCCTCGGCTTCATCGGCCGGTTTGCGCGTGACGGCGAAG
CGGAACGCGCGGCGTTGACGACCTCGCTGCATGCGCAGCTGCAAAAACTTCGCCCGGCGCCCGCAAGTAC
CTTCATTGCCGATCGCTCTGATCGCCGCTTGTCCGACTGGTTCTACCGGCTCTCGCCATGGGCAATCGCG
GGGCTCGCATGCGGAGTCGCCGCCATCGTCTGGCTGGTGTGGTCGACCGCGCTCGACGCCCAGCTAGCGC
AACTCGTGCAAACGAAGGTCACGCGGCCGTGA