SecReT6
Protein ID: 295699896
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4293
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1191291..1191776 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDD5WII3
KEGG IDbge:BC1002_4293
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-36, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|295699896|ref|YP_003607789.1| type VI secretion system effector [Burkholderia sp. CCGE1002]
MAIPAYMWLKDDGGADIKGSVTVQGREGSVELVAFDHGVHIPTDGNTGKLTGTRVHKPITLTKETDSSTP
YLYKAVTSGQTLKSVEIRWYKIDDAGKEKEYFNTKLDNVKIVAVKPKMFDIKNPDYEKHNHLEDVELRYE
TIMWSYKDGNIIHKDTWNERS
 
Nucleotide Sequence: 486 bp     [Download]
>gi|295698848|ref|NC_014118.1|:1191291-1191776 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGGCAATTCCGGCCTATATGTGGCTCAAGGACGACGGCGGCGCTGATATCAAGGGTTCGGTGACGGTGC
AAGGCCGCGAAGGCAGCGTCGAGCTCGTCGCGTTCGATCACGGCGTGCATATCCCGACCGACGGCAACAC
CGGCAAGCTGACCGGCACCCGCGTACACAAACCCATCACGCTGACAAAGGAAACCGACTCGTCGACGCCG
TACTTGTACAAGGCGGTCACCAGCGGTCAGACGCTGAAGTCGGTCGAGATCAGGTGGTACAAGATCGACG
ACGCCGGCAAGGAGAAGGAATACTTCAACACGAAGCTCGACAACGTGAAGATCGTCGCGGTCAAGCCCAA
GATGTTCGACATCAAGAACCCCGACTACGAGAAGCACAACCACCTCGAAGACGTCGAGCTGCGCTACGAG
ACGATCATGTGGTCGTACAAGGACGGCAACATTATCCACAAGGATACGTGGAACGAGCGTTCCTGA