SecReT6
Protein ID: 295699897
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4294
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1191903..1194620 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD5WII4
KEGG IDbge:BC1002_4294
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 248..270
AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 625..789
AAA [PF00004], Evalue: 4.90E-18, Aligned region: 250..362
AAA [PF00004], Evalue: 4.90E-18, Aligned region: 630..755
ClpB_D2-small [PF10431], Evalue: 3.50E-16, Aligned region: 395..417
ClpB_D2-small [PF10431], Evalue: 3.50E-16, Aligned region: 796..868
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 250..269
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 339..380
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 629..749
AAA_16 [PF13191], Evalue: 6.60E-08, Aligned region: 93..102
AAA_16 [PF13191], Evalue: 6.60E-08, Aligned region: 227..266
AAA_16 [PF13191], Evalue: 6.60E-08, Aligned region: 295..328
AAA_16 [PF13191], Evalue: 6.60E-08, Aligned region: 507..560
AAA_16 [PF13191], Evalue: 6.60E-08, Aligned region: 603..670
AAA_16 [PF13191], Evalue: 6.60E-08, Aligned region: 693..724
AAA_16 [PF13191], Evalue: 6.60E-08, Aligned region: 769..817
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 249..335
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 539..553
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 628..649
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 691..723
AAA_25 [PF13481], Evalue: 1.50E-06, Aligned region: 250..274
AAA_25 [PF13481], Evalue: 1.50E-06, Aligned region: 304..336
AAA_25 [PF13481], Evalue: 1.50E-06, Aligned region: 623..649
AAA_25 [PF13481], Evalue: 1.50E-06, Aligned region: 810..853
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 247..271
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 627..651
Sigma54_activat [PF00158], Evalue: 3.10E-05, Aligned region: 230..264
Sigma54_activat [PF00158], Evalue: 3.10E-05, Aligned region: 628..747
AAA_17 [PF13207], Evalue: 3.40E-05, Aligned region: 250..384
AAA_17 [PF13207], Evalue: 3.40E-05, Aligned region: 485..537
AAA_17 [PF13207], Evalue: 3.40E-05, Aligned region: 629..664
IstB_IS21 [PF01695], Evalue: 6.80E-05, Aligned region: 232..272
IstB_IS21 [PF01695], Evalue: 6.80E-05, Aligned region: 496..541
IstB_IS21 [PF01695], Evalue: 6.80E-05, Aligned region: 629..647
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 228..264
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 302..399
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 628..643
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 700..711
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 250..270
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 630..659
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 244..271
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 628..669
NACHT [PF05729], Evalue: 0.00061, Aligned region: 250..277
NACHT [PF05729], Evalue: 0.00061, Aligned region: 629..653
AAA_29 [PF13555], Evalue: 0.00067, Aligned region: 243..266
AAA_29 [PF13555], Evalue: 0.00067, Aligned region: 626..654
TIP49 [PF06068], Evalue: 0.001, Aligned region: 250..268
TIP49 [PF06068], Evalue: 0.001, Aligned region: 298..330
TIP49 [PF06068], Evalue: 0.001, Aligned region: 628..664
Clp_N [PF02861], Evalue: 0.0021, Aligned region: 32..79
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 231..267
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 627..641
Mg_chelatase [PF01078], Evalue: 0.0031, Aligned region: 244..266
Mg_chelatase [PF01078], Evalue: 0.0031, Aligned region: 629..673
Protein Sequence: 905 a.a.     [Download]
>gi|295699897|ref|YP_003607790.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1002]
MTLRNDRRSAFCNTTQLLRRLNPHCARALEAAASLCQTRLADEITVEHWLLKLIEAGDGDILAVLRHYTI
DIDALWDALLGAIDRLPRNLRGKPALSPQLAALLADAWLHASSESDDARIRSGNLLQAIVDAPHILRAQH
AWPLLAVSSAQIERLLPRIAHRSCESESESESEDDERQPERPQPSATASAANVVCRAKEVTPASANALAR
FAFDLTDKARRGDIDPVFGRNREIQQMVDVLARRRKNNPILVGEPGVGKTALVEGLALRVVDGSVPNVIR
DVRILTLDLGLLQAGAGVKGEFEQRLKNLIDEVQASPVPILLFIDEAHTLIGAGNAAGGADAANLLKPAL
ARGELRTIAATTWSEYKQFFERDAALERRFQIIKVDEPDDDAACLMLRGLKTRYAQHHHVHIRDEALVAA
VKLSRRYIPARQLPDKAVDLIDTAAARVRMGLDTPPAELQRARAMVAALGLEHATLADDERAGIDDVEAR
RGALDAALANAKTELAALQTRYEQELELVQALHRQRDSEAATRDATAFAQARRALTTAQGKTPLIFRDVD
AQAIARVVAEWTGVPVGSLVEDELQSLLTLEKQLATRVVAQHDALAALSESLRTAKAGLKNEHAPLGVFL
LAGPSGVGKTETALALADLLFGGEAALTTINMSEYQESHTVSQLKGSPPGYVGYGRGGVLTEAVRQRPYS
VVLLDEVEKAHRDVLDMFYQVFDRGMMRDGEGREIDFRNCVVLMTSNLGSAQIDETTAENPDVSHNELLD
AIHPQLVRHFQPALLARFQTLVYRPLDASALASIVRLKLAKVAQRLYRQHGVELNCDDALIDAMAELCLA
RETGARNVDAFLNQRILPSLSRELLARMACETAPAKILLTSSPEGKLTIDFFDREQAVADHAANG
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|295698848|ref|NC_014118.1|:1191903-1194620 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGACCTTGCGCAACGACCGAAGAAGCGCCTTTTGTAACACCACCCAGCTGCTGCGCCGGCTGAACCCAC
ACTGCGCACGGGCGCTCGAAGCGGCCGCCAGTCTTTGCCAGACGCGGCTGGCTGACGAGATCACGGTCGA
GCACTGGCTGCTGAAGCTGATCGAAGCCGGCGATGGCGACATCCTCGCTGTCCTGCGGCATTACACGATC
GATATCGACGCGCTGTGGGATGCGCTACTCGGTGCAATCGATCGCCTGCCGCGCAATCTGCGCGGCAAGC
CCGCGCTGTCGCCGCAGCTAGCGGCACTGCTAGCGGATGCATGGCTTCACGCGTCGTCGGAGAGCGACGA
CGCGCGAATCCGCTCCGGGAATCTGTTGCAGGCGATCGTCGATGCGCCCCACATACTCCGCGCGCAGCAT
GCGTGGCCATTGCTTGCCGTCAGCAGCGCGCAGATCGAGCGTTTGCTGCCGCGAATTGCGCATCGGTCGT
GCGAAAGTGAAAGCGAAAGCGAAAGTGAAGATGACGAACGGCAACCCGAACGGCCGCAACCTTCGGCGAC
CGCCTCGGCGGCGAACGTCGTCTGTCGCGCAAAGGAGGTCACACCCGCCAGCGCCAACGCCCTCGCCCGC
TTCGCGTTCGACCTGACCGACAAGGCGCGCCGCGGCGACATCGATCCGGTATTCGGGCGCAACCGCGAGA
TCCAGCAGATGGTCGACGTGCTCGCGCGCCGTCGCAAGAACAATCCGATCCTCGTCGGCGAGCCGGGGGT
CGGCAAGACCGCGCTCGTCGAAGGGCTCGCGTTGCGAGTCGTAGATGGCAGCGTGCCGAACGTGATCCGC
GACGTGCGCATCCTCACGCTCGATCTCGGCTTGCTGCAAGCCGGCGCCGGCGTAAAAGGCGAATTTGAGC
AACGCCTGAAGAACCTGATCGACGAGGTTCAGGCTTCGCCCGTGCCGATCCTGCTGTTCATCGACGAAGC
TCACACGCTGATCGGCGCCGGCAACGCCGCGGGCGGCGCCGACGCCGCGAACCTGCTGAAGCCAGCGCTC
GCGCGCGGCGAATTGCGCACGATCGCGGCGACCACGTGGTCCGAATACAAGCAATTCTTCGAGCGCGACG
CCGCACTGGAACGCCGCTTCCAGATCATCAAAGTCGACGAACCCGACGACGACGCGGCCTGCCTGATGCT
ACGCGGCCTGAAAACCCGCTACGCCCAGCACCATCACGTGCACATTCGCGACGAAGCACTGGTCGCCGCA
GTCAAGCTGTCGCGCCGCTACATACCGGCACGGCAGTTGCCGGACAAGGCCGTCGATCTGATCGACACCG
CGGCCGCACGCGTACGCATGGGGCTCGACACACCGCCGGCCGAATTGCAACGCGCGCGTGCCATGGTTGC
CGCGCTGGGGCTCGAACACGCGACGCTCGCAGACGACGAACGCGCCGGCATCGACGATGTCGAAGCGCGC
CGCGGCGCGCTGGACGCCGCGCTCGCGAACGCGAAGACCGAACTCGCGGCGCTGCAAACACGTTACGAAC
AGGAGCTCGAACTCGTCCAGGCGCTGCACCGCCAACGCGACAGCGAGGCCGCAACCCGCGATGCCACCGC
GTTCGCGCAAGCACGTCGCGCACTCACGACCGCGCAAGGCAAGACCCCGTTGATCTTCAGGGACGTCGAC
GCCCAGGCAATCGCACGCGTCGTCGCCGAGTGGACCGGCGTGCCGGTTGGCAGCCTCGTCGAAGACGAAC
TGCAAAGCCTGCTGACACTGGAGAAGCAGCTCGCGACACGCGTGGTCGCGCAGCATGACGCGCTCGCTGC
GCTGTCCGAAAGCCTGCGCACCGCCAAGGCGGGGCTCAAGAATGAACATGCGCCGCTCGGCGTGTTTCTG
CTTGCTGGACCATCGGGCGTTGGCAAGACCGAAACTGCGCTTGCGCTCGCCGATTTGCTGTTCGGCGGTG
AAGCCGCGCTGACGACGATCAATATGTCCGAGTACCAGGAATCGCACACGGTGTCGCAATTGAAGGGCTC
GCCGCCAGGCTACGTCGGATATGGACGCGGCGGCGTTCTGACCGAGGCGGTGCGGCAGCGTCCGTATAGC
GTCGTGCTGCTCGACGAAGTCGAAAAAGCGCACCGCGATGTGCTCGACATGTTTTATCAGGTGTTCGATC
GCGGCATGATGCGCGACGGCGAGGGGCGCGAGATCGACTTTCGCAACTGCGTGGTCCTGATGACGTCGAA
TCTCGGCAGTGCTCAAATCGACGAAACGACCGCGGAAAACCCCGACGTCTCGCACAACGAACTGCTCGAC
GCGATCCATCCGCAGCTCGTCAGACACTTCCAACCTGCGCTGCTCGCGCGTTTCCAGACGCTCGTGTACC
GCCCTCTCGACGCGAGCGCGCTGGCGTCGATCGTGCGCCTGAAGCTCGCTAAAGTCGCGCAACGTCTATA
CCGTCAGCACGGCGTCGAACTGAACTGCGACGATGCGCTGATCGATGCGATGGCCGAGCTGTGTCTCGCG
CGCGAAACGGGCGCGCGCAATGTCGATGCGTTTCTCAATCAGCGCATTCTGCCGTCGTTGTCGCGTGAAC
TGCTCGCGCGCATGGCATGCGAAACCGCGCCTGCCAAGATCCTGCTGACCAGCTCGCCCGAAGGCAAGTT
GACGATCGATTTTTTCGATCGCGAACAAGCCGTCGCCGACCACGCGGCGAACGGCTGA