SecReT6
Protein ID: 295699898
SecReT6 ID492
T6SS typei2
Gene symbol-
Locus tagBC1002_4295
StrainBurkholderia sp. CCGE1002
Repliconchromosome II [GenBank: NC_014118] [Browse all T6SS(s) in this replicon]
Location [Strand]1194635..1195060 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD5WII5
KEGG IDbge:BC1002_4295
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-17, Aligned region: 32..114
Protein Sequence: 141 a.a.     [Download]
>gi|295699898|ref|YP_003607791.1| type VI secretion system lysozyme-like protein [Burkholderia sp. CCGE1002]
MPAGPSLYDVLLGQIGGEPLDAYDDRTLECLSVQQNVQRILNTRAGALKHLTDYGLPDMTNIYKALPSSA
HALKQQMEATLLKYEPRIRAIDIDILEDDDPGVLVSFEMTCHLNKPGLVRFGTYFEPPGRLHIRRRIQGR
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|295698848|ref|NC_014118.1|:1194635-1195060 Burkholderia sp. CCGE1002 chromosome 2, complete sequence
ATGCCGGCGGGACCATCCCTCTACGACGTGCTGCTCGGCCAGATCGGCGGCGAGCCGCTCGATGCCTATG
ACGATCGCACGCTCGAATGCCTGAGCGTCCAGCAGAACGTGCAGCGCATTCTGAACACTCGCGCGGGCGC
GTTAAAACACCTGACCGACTACGGGCTGCCGGACATGACGAACATCTACAAGGCATTGCCATCGTCGGCG
CACGCGCTGAAGCAGCAGATGGAAGCGACGCTGCTGAAATACGAGCCCCGGATTCGCGCTATCGACATCG
ACATCCTCGAGGACGATGATCCCGGCGTGCTGGTCAGCTTCGAAATGACGTGTCATTTGAATAAGCCGGG
GCTCGTCCGCTTCGGCACGTATTTCGAGCCACCAGGGCGGCTACATATACGACGCAGGATACAGGGACGC
GAGTAA