SecReT6
Protein ID: 296101895
SecReT6 ID395
T6SS typei3
Gene symbolvasD
Locus tagECL_01533
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1551980..1552483 [+]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDD5C6E7
KEGG IDenc:ECL_01533
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-30, Aligned region: 19..142
Protein Sequence: 167 a.a.     [Download]
>gi|296101895|ref|YP_003612041.1| type VI secretion system protein VasD [Enterobacter cloacae subsp. cloacae ATCC 13047]
MNNKNFHKLWFVFYAVIFALVSGCSSSSHSDPSRYNLQFQAHPQINDSAPLKVRVLLLKSDADFMSSDFY
SLQNNASATLGANLLNSDVFFLMPGQLSKTLSGQSSPEARYIGVMAEYQMLDGKKWRVSLPLPVPGENHL
YQFWKWSSDELQANVFLDINGIRVISQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1551980-1552483 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAATAATAAAAATTTTCATAAGCTGTGGTTCGTCTTTTACGCGGTGATATTCGCCCTGGTCAGTGGTT
GTTCGTCGTCTTCACACAGCGACCCCTCCCGCTACAATCTGCAGTTTCAGGCTCATCCACAAATCAATGA
TTCTGCGCCGCTTAAAGTCAGAGTGCTGCTGTTGAAGTCCGATGCGGATTTCATGTCCAGTGACTTCTAT
TCCCTGCAGAACAACGCGTCAGCCACGCTTGGCGCGAATCTGCTGAACAGCGATGTTTTCTTCCTGATGC
CGGGCCAGCTTTCGAAAACCCTTAGCGGACAAAGCTCACCCGAGGCGCGCTATATCGGTGTTATGGCCGA
ATATCAGATGCTGGATGGAAAGAAATGGCGTGTCTCACTCCCACTGCCTGTTCCGGGCGAAAACCATCTC
TACCAGTTCTGGAAATGGTCATCCGATGAACTCCAGGCCAATGTCTTTCTCGACATAAATGGCATCCGGG
TCATCAGCCAGTAA