SecReT6
Protein ID: 296101896
SecReT6 ID395
T6SS typei3
Gene symbolvasE
Locus tagECL_01534
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1552509..1553852 [+]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDD5C6E8
KEGG IDenc:ECL_01534
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.30E-138, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|296101896|ref|YP_003612042.1| type VI secretion system protein ImpJ [Enterobacter cloacae subsp. cloacae ATCC 13047]
MTKAEKVVWTEGMFLRPHHFQRTESYLLNHVREWGALQRSYLWGFLDVELDEAMLRQGCIALSYASGVLP
DGTFFQVRNGRNGPAPLKIPDNLTNEKVVLALPVRRGEREEVIFSEEPASLARFIAFEQEVEDDNAMSVG
DATVQFGRLRLTLMLEKDLTAEWTAIGIAFVAEKRNDNHVRLDSSYIPPMLNACNSPQLYSMVNDLHGLL
VQRSQQIGGRLRQPGRFNTSELIEFTLLSLVNRHLGEVSHLKTLPLLHPETLWRSWLPFATELATWTSQR
TAESVLPIYDHDDLAGCFSKLMLMLRQGLSLVMEDQAIQLPLNERSHGLNIATVPETSMVREFGFVLAVK
ANVPGEHLQTHFPAQMKVAPVSKIRDLVQLQLPGIMLRAMPVAPPQIPWHAGYSYFELEKGSELWHEMDK
SGAFALHLAGEFPGLDMEFWAIRSPTE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1552509-1553852 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGACCAAAGCAGAGAAGGTCGTCTGGACCGAAGGCATGTTCCTGCGTCCACACCATTTTCAACGGACAG
AAAGTTATCTGCTCAACCACGTTCGGGAATGGGGTGCGCTGCAGCGATCGTATCTTTGGGGCTTCCTCGA
TGTTGAACTGGACGAAGCGATGCTTCGCCAGGGCTGCATTGCCCTGAGCTATGCCAGCGGTGTGCTACCC
GACGGTACGTTTTTCCAGGTTCGCAATGGGCGCAATGGCCCAGCCCCGCTGAAAATTCCCGACAATCTCA
CCAACGAAAAGGTGGTGCTCGCGCTGCCGGTACGTAGGGGAGAGCGTGAAGAGGTTATTTTCAGCGAAGA
GCCCGCGTCACTGGCGCGTTTCATCGCCTTCGAGCAGGAAGTGGAAGACGATAACGCCATGTCGGTGGGG
GATGCCACGGTGCAGTTTGGCCGTTTACGTCTGACCCTGATGCTGGAAAAAGATCTGACGGCCGAATGGA
CGGCGATTGGCATCGCGTTTGTCGCGGAAAAGCGCAACGACAACCATGTGCGTCTGGATAGCAGCTACAT
TCCGCCGATGCTGAACGCCTGCAACAGCCCGCAACTTTACAGCATGGTCAACGATCTCCACGGCTTGCTG
GTGCAGCGCAGCCAGCAGATTGGGGGGCGTTTGCGCCAGCCTGGCCGCTTTAACACCTCTGAGCTGATCG
AATTTACGCTGCTGTCGCTGGTTAACCGTCACCTGGGCGAAGTCTCCCATTTAAAAACGCTCCCGCTACT
GCACCCGGAAACGCTCTGGCGCAGCTGGCTGCCGTTTGCCACGGAGCTTGCCACCTGGACCTCGCAACGC
ACCGCCGAAAGCGTGCTGCCGATTTACGATCACGACGACCTTGCGGGATGCTTCAGCAAGCTGATGCTGA
TGCTGCGTCAGGGGTTGTCGCTGGTGATGGAAGATCAGGCCATTCAGCTGCCGCTGAACGAGCGCTCTCA
TGGCCTGAACATCGCCACGGTGCCGGAAACCAGCATGGTGCGCGAGTTCGGCTTCGTCCTGGCGGTCAAA
GCCAACGTGCCGGGCGAACACCTGCAAACCCATTTCCCTGCCCAGATGAAAGTCGCGCCGGTGTCGAAAA
TCCGCGATCTGGTTCAGTTACAGCTGCCGGGCATCATGCTGCGCGCCATGCCGGTTGCGCCGCCGCAAAT
CCCATGGCATGCGGGCTACAGCTACTTTGAGCTGGAGAAGGGCAGCGAGCTGTGGCACGAGATGGATAAG
TCCGGTGCATTCGCCCTGCATCTCGCAGGGGAGTTCCCGGGTCTTGATATGGAGTTTTGGGCCATCCGTA
GCCCGACTGAATAA