SecReT6
Protein ID: 296101897
SecReT6 ID395
T6SS typei3
Gene symbolimpK
Locus tagECL_01535
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1553870..1555108 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDD5C6E9
KEGG IDenc:ECL_01535
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.60E-69, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 3.60E-69, Aligned region: 369..389
OmpA [PF00691], Evalue: 2.10E-14, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|296101897|ref|YP_003612043.1| type VI secretion system protein ImpK [Enterobacter cloacae subsp. cloacae ATCC 13047]
MQERQDTGSDAAFTGASSNNQLVAAANPLLNAIPQIRHSVSHDDQVALRQRLIDEIRRFEVRCQQAGLAY
EVIVGARYCLCTALDEAAALTPWGSSGVWSSNGLLVTFHNETWGGEKFFQLLARLSQNPREHILLLEMIN
YCLLLGFEGRYRVLDNGRTQLETIKQRLWQMIRGVRGSYPAPLSPHPEDRPVLRKLWRPMVPLWACVALA
GFIACLFYIILNWRLGDNTNPVLAKIYQSQLPETTIQQPARQLPAVLNLRGFLKPEIDAGLVAVKDEADR
SVVILKGDGLFASASTVVRDRYEPVINRIAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLDRARSV
QKMLQGSLSQPDRVKAEGRGEINPVAPNNTPENRARNRRVEITLLVSPENTQAELNGLPQGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1553870-1555108 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCAGGAACGACAGGATACCGGCAGTGATGCCGCGTTTACCGGAGCCAGTAGTAACAATCAGCTGGTGG
CGGCCGCCAATCCGCTGCTCAACGCGATTCCGCAAATCCGTCATTCGGTGTCTCATGACGATCAGGTGGC
ACTGCGCCAGCGTCTGATCGACGAGATTCGCCGTTTTGAAGTCCGCTGCCAGCAGGCAGGGCTGGCTTAT
GAGGTGATCGTCGGGGCGCGCTATTGCCTCTGCACGGCGCTGGATGAAGCCGCGGCGCTGACCCCCTGGG
GCAGCAGCGGTGTCTGGTCAAGCAATGGTCTGCTGGTCACGTTTCATAACGAAACCTGGGGCGGCGAAAA
GTTCTTCCAGCTGCTGGCGCGTCTGTCGCAGAACCCGCGTGAACATATCCTCCTGCTGGAGATGATCAAC
TACTGCCTGCTGCTCGGTTTCGAAGGGCGCTATCGGGTTCTGGATAATGGCCGCACCCAGCTGGAAACTA
TCAAGCAGCGGCTGTGGCAGATGATCCGTGGCGTGCGCGGCAGCTATCCGGCACCGCTCTCTCCACACCC
GGAAGATCGTCCCGTGCTGCGCAAGCTGTGGCGGCCGATGGTGCCGCTGTGGGCCTGTGTCGCGCTGGCC
GGGTTTATCGCCTGCCTGTTCTACATCATTCTCAACTGGCGTCTTGGCGACAACACCAACCCGGTACTGG
CGAAGATTTACCAGTCTCAGTTGCCTGAAACCACCATTCAGCAACCTGCGCGTCAACTGCCTGCGGTGCT
TAACCTGCGTGGCTTCCTGAAGCCGGAAATCGACGCCGGTCTGGTGGCGGTGAAAGATGAAGCGGATCGC
AGCGTGGTGATCCTGAAAGGAGACGGGCTGTTTGCTTCTGCTTCTACCGTGGTGCGTGACCGCTATGAGC
CGGTCATCAACCGGATCGCCCAGGCGATGAACAACGTCAGCGGCAAAATTCTGGTGGTGGGCTACAGCGA
TAACGTGCCAATTCGCAGCGCGCGCTTCGCCTCCAACTATGAACTCTCTTTGGATCGCGCCCGGTCCGTG
CAAAAAATGTTGCAGGGAAGCCTCTCCCAGCCTGACCGCGTGAAAGCGGAAGGGCGGGGAGAGATCAATC
CTGTGGCGCCAAACAATACGCCTGAAAACCGCGCCCGTAACCGCCGTGTGGAAATAACTCTGCTGGTGTC
GCCTGAAAATACGCAGGCTGAGCTGAACGGATTGCCGCAAGGAAACTAA