SecReT6
Protein ID: 296101900
SecReT6 ID395
T6SS typei3
Gene symbolimpA
Locus tagECL_01538
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1559476..1560492 [+]
Producttype VI secretion system protein ImpA
NoteTssA
UniProt IDD5C6F2
KEGG IDenc:ECL_01538
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-20, Aligned region: 52..111
Protein Sequence: 338 a.a.     [Download]
>gi|296101900|ref|YP_003612046.1| type VI secretion system protein ImpA [Enterobacter cloacae subsp. cloacae ATCC 13047]
MNIEEFLAPISPEKPCGDNLEYDADFQAMGQASQGKAEQQFGDTIIPAEPADWNTVEKLATSLLGRTKDL
RVMLALTHAWTRRRGLPGYADGLLLVQEAITRYWEPLYPLLEEYGETDPFYRINALAALSDKSDLTVALR
NASLLRSNGDEISLRDAQALLDGSKTECPDYPGGRPRLIDELARGDQPGTEAVILINERLLAIRDLLSGY
LGESGVPEMEQLLKTVGLVASACQVTDISKLLPNRDAQAEHHAEPQTVATQPVQQVTDWRSVQVTSRADA
QLMLEKAKQYFAQYEPSHPAPLMIERVQRLSELNFMDIIRDLAPDGVNQLENIFGRRE
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1559476-1560492 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAATATCGAAGAATTTCTCGCGCCGATAAGCCCCGAAAAACCCTGCGGCGACAACCTTGAGTACGACG
CCGATTTTCAGGCTATGGGACAGGCAAGCCAGGGTAAAGCGGAACAGCAGTTCGGCGACACGATCATTCC
CGCCGAGCCCGCTGACTGGAATACGGTAGAAAAGCTCGCCACCAGCCTGCTGGGGCGCACCAAAGATCTT
CGCGTCATGCTGGCGTTAACCCATGCCTGGACCCGACGTCGTGGGCTGCCGGGCTACGCGGACGGCCTGC
TGCTCGTGCAGGAGGCGATCACCCGCTACTGGGAGCCGCTCTATCCACTGCTGGAGGAGTATGGCGAAAC
GGACCCGTTCTATCGCATTAACGCCCTTGCCGCGCTGAGCGATAAATCTGACCTGACCGTCGCGCTGCGA
AACGCCTCGCTGCTGCGCTCAAACGGCGATGAAATTTCGCTGCGTGACGCGCAGGCATTGCTGGATGGCA
GCAAAACCGAATGCCCGGATTATCCCGGCGGCCGCCCAAGACTGATTGACGAACTGGCGCGCGGCGACCA
GCCAGGTACAGAGGCCGTCATCCTGATTAATGAAAGGCTGCTGGCCATTCGCGATCTGCTTAGCGGTTAC
CTTGGTGAAAGCGGCGTACCGGAAATGGAGCAGTTGCTGAAAACCGTGGGCCTGGTCGCCAGCGCCTGTC
AGGTGACCGACATCAGCAAACTGCTGCCCAATCGGGATGCACAGGCGGAACACCACGCTGAGCCGCAGAC
GGTGGCCACCCAACCCGTGCAGCAGGTCACCGACTGGCGCAGCGTGCAGGTTACCAGTCGCGCCGACGCC
CAGCTGATGCTGGAGAAAGCGAAACAGTATTTTGCGCAGTACGAACCGAGCCACCCCGCACCGCTGATGA
TTGAACGGGTGCAGCGGCTGTCAGAACTTAACTTCATGGACATTATTCGCGACCTGGCGCCAGACGGCGT
TAACCAACTGGAAAATATCTTTGGACGCCGCGAATGA