SecReT6
Protein ID: 296101902
SecReT6 ID395
T6SS typei3
Gene symbolimpC
Locus tagECL_01540
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1561096..1562595 [+]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDD5C6F4
KEGG IDenc:ECL_01540
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|296101902|ref|YP_003612048.1| type VI secretion system protein ImpC [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSNQTQQHEQQAGQAFSQDEFSALLNKEFRPKTDQARSAVESAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEQLSQQVNQIIHHEEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVGWDQS
PIFKKIYEQEYGQFGGEPFGCIVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHNSYAWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFREREEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKTKDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1561096-1562595 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAGCAACCAGACTCAACAACACGAGCAGCAGGCAGGTCAGGCGTTCAGTCAGGACGAGTTCAGCGCAC
TGCTGAACAAAGAGTTCCGTCCTAAAACTGACCAGGCGCGTTCCGCCGTCGAGAGCGCGGTAAAAACTCT
GGCGCAGCAGGCGCTGGAAAACACCGTTACCTTCTCCAACGACACCTATCGCACCATCCAGAACCTGATT
GCGGGTATCGACGAACAGCTCTCTCAGCAGGTGAATCAGATCATTCACCACGAAGAGTTTCAGAAGCTGG
AGAGCGCCTGGCGCGGTCTGAGCTATCTTGTGAACAACACTGAAACCGACGAGATGCTGAAGATCCGCTT
TATGAGCATCTCCAAGCAGGAGCTGGGCCGTACCCTGAAACGCTATAAGGGTGTGGGCTGGGATCAGAGC
CCGATCTTCAAGAAAATCTACGAGCAGGAGTACGGTCAGTTTGGTGGTGAGCCGTTTGGCTGCATCGTCG
GCGACTACTACTTTGACCACAGCCCGCAGGACGTTGAACTGCTGGGTGAAATGGCGCGCATCGGCTCTGC
GGCTCACTGTCCGTTCATCACCGGTACCGCACCGGGCGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCT
AACCCACGCGATCTGACCAAAATCTTCCAGAACACCGAATACGCCGCCTGGCGTTCACTGCGTGAATCGG
AAGATGCCCGCTATCTGGGCCTGGTGATGCCGCGCTTCCTGTCTCGCCTGCCTTACGGCATTCGTACTAA
CCCGGTCGACAGCTTTGACTTTGAAGAGCAGACCGACGGCGCGAACCACAACAGCTACGCCTGGGCGAAT
GCTGCTTACGCGATGGCGGCCAACATCAACCGCTCTTTCAAAGAGTACGGCTGGTGCACCTCCATTCGCG
GCGTGGAGTCCGGCGGGGCGGTTGAAAACCTGCCGTGCCATACCTTCCCGAGCGACGACGGCGGCGTGGA
CATGAAATGTCCGACCGAGATCGCCATCAGCGACCGTCGCGAAGCCGAGCTGGCGAAAAATGGCTTTATG
CCGCTGGTTCACCGCAAAAACTCCGACTTTGCTGCCTTCATTGGCGCGCAGTCGCTGCAAAAACCGGCCG
AGTACCACGACCCGGATGCCACCGCCAACGCGCGTCTGGCCTCCCGTCTGCCGTACCTGTTCGCCTGCTG
CCGCTTTGCGCATTACCTGAAGTGCATCGTGCGTGACAAAATCGGCTCCTTCCGCGAGCGCGAAGAGATG
GAACGCTGGCTGAACGACTGGGTCATGAACTACGTGGACGGTGACCCGGCTAACTCCTCTCAGGAGACCA
AGTCCCGCAAGCCACTGGCCGCTGCAGAAGTCCAGGTGCAGGAGATTGAAGACAACCCGGGCTACTATGC
CGCGAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGTCTGACCGTTTCTCTGCGTCTGGTATCTAAA
CTGCCGTCGCTGAAGACGAAAGACGCGTAA