SecReT6
Protein ID: 296101906
SecReT6 ID395
T6SS typei3
Gene symbol-
Locus tagECL_01544
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1564401..1566170 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDD5C6F8
KEGG IDenc:ECL_01544
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-09, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 28..49
UreE_N [PF02814], Evalue: 0.0033, Aligned region: 78..99
Protein Sequence: 589 a.a.     [Download]
>gi|296101906|ref|YP_003612052.1| FHA domain-containing protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MRFTIISTKPGHQPPQSSCDFYAPGGTIGRGTDNNLVLPDNDRTISRLQAIVHVDAQGECRVTNRGSVTR
VVLNDIPLERGRQVELQDGDILGIDDYRIEVTELIHDTQPVSRMAASMQQQARPTVAPTPAPQPKPASAA
PRGKAEPTAVPSEIWDSLMQEFSISDSISSNRAKPQPAASHDPFSQPAAPERNAEDPLAMFNDSEPKLER
KNVDPDTLFSDEALFKKESIFDDVTPSTLVPPVESKPAPAEEATDELDPLALFGGSASAPAARNDDPLGL
MGGAPLTHPDEIVPEPSAPAPEPEAVPQDDPLADSPLFAPEPQDPPRAEEEEPVRTDYAGFTMPTPQAVA
RSSAQTPKGRLRIDPVKNAAVPSATAQNGEKGEVLQGELLEALLEGMGLSEMQPVPQFDRENMRQLGQIL
GMFSQGTVALLSSRSILKRGVKADMTMVLDDANNPFKLLPTGKTVLIQMFGTPMPGFMPPTKSVRDALID
LQAHQLGMISGIRAIIAAMLQSFNPEQLEEQAKQNGMTSRLALPGSRKAALWDYFVRSYGETAGEIEDDF
HTLFGEAFLHAYDMEVNQYKDSQSGSEEK
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1564401-1566170 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCGATTCACGATTATTTCTACGAAACCCGGTCATCAGCCGCCGCAGAGCAGTTGTGATTTTTATGCCC
CCGGGGGCACTATTGGGCGCGGTACGGATAACAATCTGGTACTGCCGGACAATGACCGTACCATCTCGCG
CCTGCAGGCTATTGTTCACGTTGACGCCCAGGGCGAATGCCGCGTGACCAACCGTGGCAGCGTCACCCGC
GTGGTTTTGAACGACATCCCGCTGGAGCGGGGGCGTCAGGTAGAGCTGCAGGACGGGGATATTCTCGGTA
TTGATGACTACCGCATCGAAGTGACGGAACTTATCCACGACACGCAGCCGGTGAGCCGCATGGCCGCCAG
TATGCAGCAGCAGGCTCGCCCGACAGTGGCGCCGACACCTGCTCCGCAGCCGAAGCCAGCCAGTGCCGCA
CCGCGCGGCAAGGCGGAGCCAACGGCCGTGCCGTCGGAAATCTGGGATAGCCTGATGCAGGAGTTCTCTA
TCTCTGACAGCATCTCCAGCAACCGCGCGAAACCGCAGCCTGCGGCGTCCCACGATCCCTTCTCGCAACC
CGCGGCACCCGAGCGTAACGCTGAAGACCCGCTGGCAATGTTTAATGACAGCGAGCCGAAGCTTGAGCGT
AAGAATGTCGATCCCGACACGCTGTTCAGCGATGAAGCATTGTTCAAAAAAGAGAGCATTTTTGACGATG
TCACCCCTTCAACGCTGGTGCCGCCGGTAGAGAGCAAACCTGCGCCTGCAGAAGAGGCGACGGATGAACT
CGACCCGCTGGCCCTGTTTGGTGGTTCGGCCAGCGCGCCAGCCGCGCGTAACGATGATCCGCTCGGGCTG
ATGGGCGGGGCGCCATTAACCCATCCGGATGAGATCGTGCCTGAGCCATCTGCACCCGCGCCAGAGCCAG
AGGCCGTACCGCAGGACGATCCGCTGGCGGATTCTCCGCTGTTTGCTCCTGAGCCACAGGATCCACCGCG
TGCGGAAGAGGAAGAGCCGGTACGTACCGATTACGCAGGCTTTACTATGCCTACGCCGCAGGCCGTCGCA
CGCAGCAGCGCACAGACGCCGAAGGGACGTCTGCGTATCGACCCGGTCAAAAACGCGGCTGTGCCAAGCG
CTACGGCGCAAAACGGTGAGAAAGGCGAGGTGCTGCAGGGCGAGCTGCTGGAGGCGCTGCTGGAAGGGAT
GGGCCTGAGCGAAATGCAGCCGGTGCCGCAGTTTGACCGTGAAAATATGCGTCAGTTGGGACAGATCCTC
GGCATGTTCTCGCAGGGCACCGTGGCGTTGCTCTCTTCGCGCTCTATCCTCAAGCGCGGCGTAAAAGCCG
ATATGACCATGGTGCTGGACGATGCCAACAACCCGTTCAAGCTGCTGCCGACCGGGAAAACGGTCCTGAT
TCAGATGTTCGGTACGCCGATGCCGGGCTTTATGCCACCCACCAAATCAGTGCGTGACGCGCTAATCGAT
CTGCAGGCGCATCAGCTGGGGATGATCTCCGGTATCCGCGCCATCATCGCCGCAATGCTGCAGTCCTTTA
ACCCGGAGCAACTGGAAGAGCAGGCGAAGCAGAACGGCATGACCTCTCGTCTGGCGCTGCCGGGCAGCCG
CAAAGCCGCGCTGTGGGACTACTTTGTTCGCAGCTATGGCGAGACGGCCGGTGAGATTGAGGATGACTTC
CACACCCTGTTTGGCGAAGCGTTCCTTCATGCCTATGACATGGAGGTCAATCAGTACAAAGACTCACAGA
GCGGATCGGAAGAAAAATGA