SecReT6
Protein ID: 296101909
SecReT6 ID395
T6SS typei3
Gene symbolimpE
Locus tagECL_01547
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1567977..1568789 [+]
Producttype VI secretion system protein ImpE
NoteTagJ
UniProt IDD5C6G1
KEGG IDenc:ECL_01547
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.40E-41, Aligned region: 140..263
TPR_19 [PF14559], Evalue: 0.0028, Aligned region: 12..68
TPR_19 [PF14559], Evalue: 0.0028, Aligned region: 105..113
Protein Sequence: 270 a.a.     [Download]
>gi|296101909|ref|YP_003612055.1| type VI secretion system protein ImpE [Enterobacter cloacae subsp. cloacae ATCC 13047]
MNTLYQHLAGESLSDALVRLENEIKARPADADLRAAFVQFLTLSGNWTRALTQLKSWLALKPQAKPTVTL
LEQCIQGELQRAQVMAGERRPAMPEAQWPWLTTLAAALSESDERAHALRLEALEQAQASAGQWTLENDET
QTFEWLMDGDARLGPVCETLVNGRYFWLPFSAIAEIRFQTPASVTDLVWRHALVRLTDGTEQVCQIPARY
PFAADASDAVKLARTTEWLPLDDDGTLYEGLGQKAWLSEQSESPLLSLSLVTFATDGAHE
 
Nucleotide Sequence: 813 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1567977-1568789 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAATACGCTCTATCAACATCTGGCGGGCGAGTCGCTCAGCGACGCGCTGGTGCGTCTTGAAAACGAGA
TTAAAGCCCGTCCGGCGGATGCCGATCTCCGTGCCGCGTTTGTGCAGTTTCTCACCCTCAGCGGTAACTG
GACGCGCGCGCTGACCCAGCTGAAAAGCTGGCTGGCGCTTAAGCCGCAGGCGAAACCCACCGTCACCCTG
CTGGAGCAGTGCATTCAGGGAGAACTGCAGCGCGCGCAGGTGATGGCGGGAGAACGTCGTCCGGCCATGC
CGGAAGCCCAGTGGCCATGGCTGACCACCCTTGCTGCCGCGCTGAGCGAGAGCGATGAACGCGCTCACGC
GCTGCGTCTGGAAGCCCTTGAACAGGCGCAGGCGAGCGCGGGGCAATGGACGCTAGAGAATGATGAGACG
CAGACCTTTGAATGGCTGATGGACGGCGATGCCCGTCTGGGGCCGGTGTGCGAAACCCTTGTTAACGGCC
GTTACTTCTGGCTGCCGTTTAGCGCTATCGCAGAGATCCGTTTCCAGACGCCGGCCAGCGTCACCGATCT
GGTCTGGCGTCATGCGCTGGTGCGTTTGACCGATGGGACGGAGCAGGTGTGTCAGATCCCGGCGCGTTAT
CCTTTTGCAGCCGATGCCTCTGACGCCGTTAAACTCGCACGCACCACCGAGTGGCTGCCGCTCGATGATG
ACGGCACTCTGTATGAAGGGTTGGGGCAGAAAGCCTGGCTCAGCGAGCAAAGCGAAAGCCCGCTGCTGTC
GCTGAGTCTCGTTACTTTTGCAACGGATGGAGCCCATGAGTAA