SecReT6
Protein ID: 296101910
SecReT6 ID395
T6SS typei3
Gene symbolimpF
Locus tagECL_01548
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1568782..1569345 [+]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDD5C6G2
KEGG IDenc:ECL_01548
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-19, Aligned region: 56..166
Protein Sequence: 187 a.a.     [Download]
>gi|296101910|ref|YP_003612056.1| type VI secretion system protein ImpF [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSNPAGEGDLLRSGWQARSKQEKVGARDKMQPSLLDRLTDNDPEKKRESANSNLITHAALRRNVLRDLQW
LFNTINHDASGDLSMLPHVSRSVVNFGVAPLAGKRMSDIEWHDIQRKLTEAIVNFEPRILPQGLQVRCVS
DTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 564 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1568782-1569345 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAGTAATCCTGCTGGCGAAGGCGATCTGCTGCGCAGCGGCTGGCAAGCCCGCAGTAAGCAGGAGAAGG
TGGGGGCGCGCGATAAAATGCAGCCCTCGCTGCTCGATCGCCTCACCGATAACGACCCGGAGAAAAAGCG
CGAGTCGGCCAACAGCAACCTGATCACCCATGCCGCGCTGCGTCGCAACGTGCTGCGGGATCTGCAGTGG
CTGTTTAATACCATCAATCACGACGCCTCCGGCGATTTGAGCATGCTGCCACACGTAAGCCGTTCGGTAG
TGAATTTTGGCGTTGCGCCGCTGGCCGGAAAGCGCATGTCGGATATCGAATGGCACGACATTCAGCGCAA
ACTCACCGAGGCCATTGTCAACTTTGAACCCCGCATTTTGCCCCAGGGGCTGCAGGTCCGCTGTGTGTCG
GACACCTCCTCGCTGGATCTGCACAACGTGCTCTCCATCGAGATAAAAGGGCGTTTGTGGTGTGTGCCGT
ACCCGCTGGAGTTTCTGTTTCGTACCGATGTCGATCTGGAAAACGGCCACTTTGAACTGAAAGATGCGGG
GTGA