SecReT6
Protein ID: 296101911
SecReT6 ID395
T6SS typei3
Gene symbolimpG
Locus tagECL_01549
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1569342..1571219 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDD5C6G3
KEGG IDenc:ECL_01549
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.30E-209, Aligned region: 7..625
Protein Sequence: 625 a.a.     [Download]
>gi|296101911|ref|YP_003612057.1| type VI secretion system protein ImpG [Enterobacter cloacae subsp. cloacae ATCC 13047]
MIVESKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYTERLMEGFAFLTSRVQMKMDAEF
PRFSQRLLEMIAPNYLAPTPSMAIAEIQPDSSRGDLSNGFIVPRGTMMDSLALKKTGVTCSYTTAHEVNL
LPLKIDKVELGGVPADLPLTQLGLGQQGISSALRIRIACDGPQNLGHLDFDRLEFFLSGPDIEALKLLEL
VMEHHVGVVCQTVSKHPQRDVLASDALRQEGFDADQSLLPDDLRNFDGYRLLQEYFAFPARFRFISLSGL
SKLIQRCENEKAFDIFILLDKTDEQLERVVDASHLALHCTPVINLFPKVAARQKLSEGQHEYHLVVDNIR
PLDYEIYAVNKIYGSADGQRDDQTFRPFWSTWSGDAGNYGAYFSLRREQRVLSEHALRYGTRTGYIGSEV
FVSLVDEQHAPWQENLRYISAEVLCTSRDLPLMLQQELGQFIMADSMPVKSLTLRKGPTPPRPALAEGFS
TWRLISQLQMNYLSLMDSENEEGAAALRQLLGLYANLAETPVARQVEGVRHCVLEPVHRRVPEPGPVVFA
RGIGITLTVDERAFSGASPWLFGSVLERLFARLVSINSFTEFTLKSQQRGEIGYWAPRMGKRALV
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1569342-1571219 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
GTGATCGTGGAAAGTAAACTGCTCGAATATTACAACCGTGAGCTGGCCTATCTGCGTGAGATGGGCGCCG
AATTTGCCGAGCGCTATCCCAAAGTGGCCGGACGGCTGGGCATGCGCGGCATCGAAGTGGCGGATCCGTA
CACCGAACGACTGATGGAGGGCTTTGCCTTTCTGACCTCGCGCGTGCAGATGAAAATGGACGCGGAGTTT
CCGCGCTTCTCCCAGCGCTTGCTGGAGATGATTGCGCCGAACTATCTCGCGCCCACTCCGTCCATGGCGA
TTGCTGAAATTCAGCCTGACAGCAGCCGTGGCGATTTGAGCAACGGTTTTATCGTGCCACGCGGCACAAT
GATGGACAGCCTGGCGCTGAAGAAAACCGGCGTGACCTGCAGCTACACCACGGCGCATGAGGTGAACCTG
CTGCCGCTGAAAATCGACAAGGTTGAGCTGGGCGGTGTGCCTGCCGACCTGCCCCTGACACAGCTTGGTC
TGGGCCAGCAGGGGATCAGCAGCGCCTTACGGATCCGCATTGCCTGCGACGGTCCGCAAAACCTCGGCCA
CCTTGATTTTGACCGGCTGGAGTTTTTCCTTAGTGGCCCGGATATCGAGGCGTTAAAGCTGCTGGAGCTG
GTAATGGAGCACCATGTCGGGGTGGTCTGCCAGACCGTCAGCAAACATCCGCAGCGTGATGTGCTGGCGT
CTGATGCCCTGCGTCAGGAAGGGTTTGACGCGGATCAGTCGCTACTCCCGGACGATCTGCGCAACTTTGA
CGGCTACCGTCTGTTGCAGGAGTACTTTGCTTTTCCGGCCCGTTTCCGCTTCATCAGCCTGAGCGGGCTG
AGCAAACTGATCCAGCGCTGCGAAAACGAAAAAGCCTTCGATATCTTCATTCTGCTGGATAAAACCGATG
AACAGCTGGAGCGCGTTGTCGATGCCAGCCATCTGGCCCTGCACTGCACGCCAGTGATCAACCTGTTCCC
GAAGGTAGCGGCGCGTCAGAAGCTGAGCGAAGGCCAGCATGAATACCATCTGGTGGTGGATAACATCCGC
CCGCTGGATTATGAAATTTACGCGGTAAACAAGATATACGGCAGTGCGGATGGTCAGCGCGACGACCAGA
CGTTTCGTCCGTTCTGGAGCACCTGGAGCGGCGATGCAGGCAACTACGGGGCCTACTTTTCCCTGCGCCG
GGAACAACGCGTGCTCTCTGAGCACGCCCTGCGTTACGGCACCCGCACCGGCTACATTGGCTCAGAGGTC
TTTGTCTCGCTGGTGGATGAGCAGCATGCACCCTGGCAGGAGAACCTGCGCTATATCTCCGCCGAGGTGC
TGTGCACCAGCCGGGATCTGCCGCTGATGCTGCAGCAGGAGCTGGGACAGTTCATTATGGCTGACTCCAT
GCCGGTGAAGTCGCTGACCTTGCGTAAGGGGCCGACGCCGCCGCGTCCGGCGCTGGCAGAAGGGTTCAGC
ACCTGGCGGTTGATCAGCCAGCTACAGATGAACTACCTCAGCCTGATGGACAGTGAAAACGAAGAGGGCG
CCGCCGCGCTGCGTCAGCTGTTAGGGCTGTACGCCAATCTCGCGGAGACGCCGGTTGCGCGTCAGGTAGA
AGGGGTTCGTCACTGCGTGCTGGAGCCGGTTCACCGCCGCGTGCCCGAGCCGGGACCGGTCGTCTTCGCC
CGTGGCATCGGCATTACCCTGACGGTGGATGAACGTGCGTTTTCCGGTGCCAGTCCCTGGCTTTTCGGTA
GCGTGCTGGAGCGGCTGTTTGCCCGTCTGGTGTCGATCAACAGCTTCACGGAATTCACCCTGAAAAGTCA
GCAGCGCGGCGAGATCGGCTACTGGGCGCCGCGTATGGGCAAAAGGGCACTGGTATGA