SecReT6
Protein ID: 296101912
SecReT6 ID395
T6SS typei3
Gene symbolimpH
Locus tagECL_01550
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1571216..1572259 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDD5C6G4
KEGG IDenc:ECL_01550
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.10E-108, Aligned region: 27..330
Protein Sequence: 347 a.a.     [Download]
>gi|296101912|ref|YP_003612058.1| type VI secretion system protein ImpH [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSDVVTAPLKVHRLTPLPDSFWRGVRETPWRYDLFQLLRRIDAQGGERYPLGRAPLPKFEPLRLGQQPSM
SFAPSTVAQVRQREGNGLHEVSILSFGLFGPNGPLPVHMTEYARERIHHHQDTSLSAFADLFHHRLTLLF
YRAWADAQPAVSLDRADNKRFEGYLASLIGMGQPGQMDKGSLSAHARFTHAGHLTRHGRDPEGLEKILRN
YFKAPVKLIANVPQWMPLSPREQAQLGAGRRVPRMGESAFLGVAVRDVQHKFRIEIGPLSAEEYNRFLPG
EAWVTELRDWVRQYAGVEFEWETRVILRADAVQGATLGSTGRLGYNTWLGLQPQPVPRGDLVYRAER
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1571216-1572259 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAGCGACGTTGTCACTGCGCCACTGAAGGTCCATCGTCTGACGCCGCTGCCGGACAGTTTCTGGCGCG
GGGTTCGCGAGACGCCATGGCGCTACGATCTGTTCCAGCTGTTAAGGCGCATTGATGCTCAGGGCGGGGA
ACGCTACCCGCTGGGGCGTGCGCCGCTGCCAAAATTCGAGCCGCTACGCCTGGGCCAGCAGCCGTCGATG
AGTTTTGCACCTTCGACGGTGGCGCAGGTACGCCAGCGCGAAGGCAACGGGCTGCACGAGGTCTCCATTC
TGAGCTTCGGCCTGTTTGGTCCTAACGGGCCGCTGCCGGTTCACATGACCGAGTACGCCCGCGAGCGGAT
CCATCATCATCAGGACACCAGCCTGAGCGCGTTTGCCGATCTGTTCCATCATCGTCTGACGCTGCTGTTT
TATCGCGCCTGGGCCGATGCGCAGCCTGCCGTCTCCCTCGACCGCGCCGACAATAAACGTTTTGAGGGAT
ATCTGGCGTCGTTGATTGGTATGGGGCAGCCCGGCCAGATGGACAAAGGCAGCCTGAGCGCCCATGCCCG
CTTTACCCACGCCGGACACCTGACCCGCCACGGACGGGATCCTGAAGGTCTGGAAAAAATCCTGCGTAAC
TATTTTAAAGCCCCGGTCAAACTGATCGCCAACGTACCGCAGTGGATGCCGCTTTCACCGCGCGAGCAGG
CGCAGCTGGGAGCAGGACGCCGCGTGCCGCGGATGGGCGAATCTGCGTTTCTGGGCGTGGCGGTCCGCGA
TGTGCAGCATAAATTTCGCATCGAGATTGGCCCACTCAGCGCGGAAGAGTACAACCGGTTTTTGCCCGGT
GAAGCATGGGTAACCGAACTGCGGGACTGGGTACGCCAGTACGCAGGGGTGGAATTTGAATGGGAAACAC
GGGTGATCCTGCGCGCTGACGCCGTGCAGGGCGCCACGCTCGGCAGCACCGGGCGATTGGGGTACAACAC
CTGGCTGGGCCTTCAGCCGCAGCCTGTCCCGCGTGGCGATCTGGTGTATCGCGCAGAGCGGTAA