SecReT6
Protein ID: 296101920
SecReT6 ID395
T6SS typei3
Gene symbol-
Locus tagECL_01558
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1582007..1583935 [+]
Producthypothetical protein
NoteTssI
UniProt IDD5C6H2
KEGG IDenc:ECL_01558
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.10E-78, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 9.80E-26, Aligned region: 364..457
Protein Sequence: 642 a.a.     [Download]
>gi|296101920|ref|YP_003612066.1| hypothetical protein ECL_01558 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MLNRITVQLPVEGLLFWKLSGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQNLLTPRYINGK
VTRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLGEHQVNVEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGIAYYFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHTFTLTNAPFFSDNGDYLVTAAGYHLEENRYASGEGETIHRIDFTVIPASVS
FRPAQSTAWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNDASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWLQAERNLDINVKNDESHATEKNRTQYVGEDETLRVAKNQKAGVKGDVVCLTGNSRSDKVVNDFIIS
AGNTLRLECGESAIELSKDGSVNIIGNNFNFTAKQSAQINTLSGELHLNPADGSNAIDAPGASHQTAIQQ
EVDGFFVFNANK
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1582007-1583935 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCTCAACCGAATTACCGTTCAGCTCCCCGTCGAGGGGCTGCTTTTCTGGAAACTCTCCGGCCGCGAGG
CGATGTCCGAGTCGTTCGCCCTGACGCTGACCCTGCTCGGCACGGATGCGCGTATCGACCGCAGCAAACT
GCTGGGCCAGCCGGTCACGGTGACCATCCCCACCCAGAACCTGCTTACCCCGCGCTACATCAACGGTAAA
GTCACGCGCGTGGCGGTGAGCGCCGTTGAGCTGACGGGCACACGCTATGCGGTGTATCAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGAAGCGCGACCGTAACCTGCGTATCTTCCAGGGGCAGACGGTGCCGCAGAT
TGTGAAAACCCTGCTGGGCGAGCATCAGGTCAACGTGGAAGATAAGCTCACCGGCAGCTACCGGGTGTGG
GACTACTGTGTCCAGTATCAGGAGTCGAGCCTGGACTTCATCAGCCGCCTGATGGAGCTGGAGGGGATAG
CGTATTACTTCAGCCACGAGGCCGACAAACACACCCTGGTGCTCACCGATGCCGCCACGCAGCATCAGCC
GTTCAGCGGCTACGAGGTCATCCCCTATCACCAGACGCCGTCCGGCGGCAGCACGGACGAAGAGGGTATC
AGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGCATTTACAGCCTCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCGCAGCAGAACCCGGCCTCGCCGAAGCCAGGCAGCATTGACGTGTACGA
CTGGCCGGGGCGCTTTGTGGAGACCGGGCATGCGGAGTTCTACGCCCGCATTCGTCAGGAGCGCTGGCAG
GTGGAGCATCAGCAGATTCAGGCCACGGCCACGGCGGCGGGTATTGCGCCGGGCCACACCTTCACCCTGA
CCAACGCACCGTTCTTCAGCGATAACGGTGACTATCTGGTGACGGCGGCCGGGTATCATCTGGAAGAGAA
CCGCTATGCCAGCGGCGAAGGGGAGACCATCCACCGCATCGATTTCACGGTTATCCCGGCGTCGGTGTCG
TTCCGTCCGGCGCAGTCCACGGCGTGGCCGCGTACCTACGGCCCGCAGACGGCGAAGGTTGTCGGGCCCC
AGGGAGAGAGCATCTGGACGGACAAATATGGCCGCGTGAAGGTGAAATTCCACTGGGACCGTCTGGCAAA
AGGGGACGACACCAGCTCCTGCTGGGTGCGCGTGTCGAGCGCCTGGGCGGGCCAGGGCTACGGTGGGGTG
CAGATCCCGCGCGTGGGCGATGAGGTGGTGGTGGACTTTATCAACGGTGACCCGGACCGTCCTATTATCA
CCGGGCGCGTGTACAACGATGCCAGCATGCCACCGTGGGCGCTGCCGGCGGCGGCGACGCAGATGGGCTT
TATGAGCCGCACGAAAGATGGCTCCGTGGATAACGCCAACGCCCTGCGGTTTGAGGACAAGGCGGGTGCG
GAACAGGTGTGGCTCCAGGCCGAGCGCAATCTCGATATCAACGTCAAAAATGATGAATCGCATGCCACGG
AAAAAAATCGAACCCAATATGTGGGAGAGGATGAAACCTTACGGGTGGCAAAAAATCAGAAGGCAGGGGT
TAAAGGGGATGTGGTCTGCCTGACGGGCAACAGCCGCAGCGATAAAGTTGTTAATGACTTTATTATTTCA
GCGGGCAATACGTTGAGGCTGGAGTGTGGTGAAAGCGCTATCGAATTATCAAAAGACGGGAGCGTGAATA
TCATTGGCAATAACTTTAACTTTACCGCAAAACAGAGTGCGCAAATAAACACGCTTTCCGGGGAATTGCA
TCTTAACCCTGCTGATGGCAGCAATGCCATCGATGCGCCAGGGGCATCTCACCAGACAGCAATCCAGCAG
GAAGTGGATGGTTTTTTTGTTTTCAATGCTAATAAGTAA