SecReT6
Protein ID: 296101923
SecReT6 ID395
T6SS typei3
Gene symbol-
Locus tagECL_01561
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1586973..1588583 [+]
Producthypothetical protein
NoteTssI
UniProt IDD5C6H5, D5C6H5
KEGG IDenc:ECL_01561
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-78, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 6.90E-26, Aligned region: 364..457
Protein Sequence: 536 a.a.     [Download]
>gi|296101923|ref|YP_003612069.1| hypothetical protein ECL_01561 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MLNRITVQLPVEGLLFWKLSGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQNLLTPRYINGK
VTRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKTLLGEHQVNVEDKLTGSYRVW
DYCVQYQESSLDFISRLMELEGIAYYFSHEADKHTLVLTDAATQHQPFSGYEVIPYHQTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQAQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQ
VEHQQIQATATAAGIAPGHTFTLTNAPFFSDNGDYLVTAAGYHLEENRYASGEGETIHRIDFTVIPASVS
FRPAQSTAWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNDASMPPWALPAAATQMGFMSRTKDGSVDNANALRFEDKAGA
EQVWIQAERNMDTSIKNDETHSVGGERSHYVKKTNCIAWKRIRSRR
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1586973-1588583 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCTCAACCGAATTACCGTTCAGCTCCCCGTCGAGGGGCTGCTTTTCTGGAAACTCTCCGGCCGCGAGG
CGATGTCCGAGTCGTTCGCCCTGACGCTGACCCTGCTCGGCACGGATGCGCGTATCGACCGCAGCAAACT
GCTGGGCCAGCCGGTCACGGTGACCATCCCCACCCAGAACCTGCTTACCCCGCGCTACATCAACGGTAAA
GTCACGCGCGTGGCGGTGAGCGCCGTTGAGCTGACGGGCACACGCTATGCGGTGTATCAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGAAGCGCGACCGTAACCTGCGTATCTTCCAGGGGCAGACGGTGCCGCAGAT
TGTGAAAACCCTGCTGGGCGAGCATCAGGTCAACGTGGAAGATAAGCTCACCGGCAGCTACCGGGTGTGG
GACTACTGTGTCCAGTATCAGGAGTCGAGCCTGGACTTCATCAGCCGCCTGATGGAGCTGGAGGGGATAG
CGTATTACTTCAGCCACGAGGCCGACAAACACACCCTGGTGCTCACCGATGCCGCCACGCAGCATCAGCC
GTTCAGCGGCTACGAGGTCATCCCCTATCACCAGACGCCGTCCGGCGGCAGCACGGACGAAGAGGGTATC
AGCCAGTGGGCGCTGGAGGACAGCGTGACGCCGGGCATTTACAGCCTCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGCTGTTCCAGGCGCAGCAGAACCCGGCCTCGCCGAAGCCAGGCAGCATTGACGTGTACGA
CTGGCCGGGGCGCTTTGTGGAGACCGGGCATGCGGAGTTCTACGCCCGCATTCGTCAGGAGCGCTGGCAG
GTGGAGCATCAGCAGATTCAGGCCACGGCCACGGCGGCGGGTATTGCGCCGGGCCACACCTTCACCCTGA
CCAACGCACCGTTCTTCAGCGATAACGGTGACTATCTGGTGACGGCGGCCGGGTATCATCTGGAAGAGAA
CCGCTACGCGAGCGGCGAAGGGGAGACCATCCACCGCATCGATTTCACGGTTATCCCGGCGTCGGTGTCG
TTCCGTCCGGCGCAGTCCACGGCGTGGCCGCGTACCTACGGCCCGCAGACGGCGAAGGTTGTCGGGCCGC
AGGGGGAGAGCATCTGGACGGACAAATATGGCCGCGTGAAGGTGAAATTCCACTGGGACCGTCTGGCAAA
AGGGGACGACACAAGCTCCTGCTGGGTGCGTGTGTCGAGCGCATGGGCAGGCCAGGGTTACGGCGGGGTG
CAGATCCCGCGCGTGGGCGATGAGGTGGTGGTGGACTTTATCAACGGTGACCCGGACCGTCCGATTATTA
CCGGGCGCGTGTACAACGATGCCAGCATGCCACCGTGGGCGCTGCCGGCAGCGGCGACGCAGATGGGCTT
TATGAGCCGCACGAAAGACGGTTCCGTGGATAACGCCAACGCCCTGCGGTTTGAGGACAAGGCGGGTGCG
GAGCAGGTGTGGATCCAGGCCGAGCGAAATATGGATACCAGCATCAAGAATGACGAAACGCACAGCGTCG
GCGGCGAGCGTAGCCATTACGTAAAGAAAACGAACTGCATCGCGTGGAAGCGAATCAGATCCAGGCGGTA
A