SecReT6
Protein ID: 296102162
SecReT6 ID396
T6SS typei2
Gene symbolimpB
Locus tagECL_01801
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1819466..1819957 [+]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDD5C7X8
KEGG IDenc:ECL_01801
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.80E-53, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|296102162|ref|YP_003612308.1| type VI secretion system protein ImpB [Enterobacter cloacae subsp. cloacae ATCC 13047]
MADTFQNEVPKARINLKLALHTGGAQKKVELPLKLLTVGDFSNGKESRPLSERKKINVNKNNLNSVLSEF
NPEVNMTVPNTLAGERTEENVTLRFSDMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EKILKDPALSQELRNEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1819466-1819957 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCTGATACGTTCCAGAACGAAGTGCCTAAGGCACGCATTAATTTAAAACTTGCATTGCATACCGGAG
GGGCGCAGAAGAAAGTTGAGTTACCCCTTAAATTACTCACTGTCGGTGATTTCAGTAACGGCAAAGAGAG
CCGGCCATTATCTGAAAGAAAGAAAATTAACGTCAACAAAAATAACCTCAATAGTGTACTTTCGGAATTT
AACCCGGAGGTCAACATGACGGTTCCGAATACGCTGGCGGGTGAGCGTACGGAAGAGAATGTGACGCTGC
GCTTTTCAGATATGAAAGATTTTGAACCCGAACAGGTGGCCCGACAAATTCCCCAACTTCGTGCCATGCT
GGCGATGCGTAATTTATTACGTGACCTCAAGTCCAATCTGCTGGATAACGCCACTTTCAGAAAAGAGCTC
GAGAAAATTCTTAAGGATCCGGCGCTGTCTCAGGAATTACGTAACGAAATGAGTGCCCTGGCCCCGAAAT
AA