SecReT6
Protein ID: 296102163
SecReT6 ID396
T6SS typei2
Gene symbol-
Locus tagECL_01802
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1819993..1821540 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDD5C7X9
KEGG IDenc:ECL_01802
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.90E-173, Aligned region: 87..509
Protein Sequence: 515 a.a.     [Download]
>gi|296102163|ref|YP_003612309.1| type VI secretion protein EvpB [Enterobacter cloacae subsp. cloacae ATCC 13047]
MLMSVNTENGSAQGQTTVLEKESVYASLFDKINLTPATSLGDINAFLDDAALSDAPAGERLTAAMQVFMD
CIRKSGQPVEKLDKTLIDHHIAELDFQISRQLDAVMHHAEFQKVESLWRGLKQLVDNTDYRQNVKTEILD
VSKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISKVSAAAHMP
FIGAVGPKFFLKESMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEQVKGPDHEKYLWTSASFSFASNMVKSFINNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLFAV
PHFQVEGMDVNLSLVSQMPKAKAKA
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1819993-1821540 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCTGATGTCTGTTAATACTGAAAATGGCTCCGCGCAGGGGCAGACCACTGTGCTGGAAAAAGAGAGCG
TCTACGCCTCCCTGTTCGACAAAATCAACCTGACCCCGGCCACAAGCCTGGGCGATATCAATGCGTTTCT
GGACGATGCCGCACTGTCTGATGCTCCGGCAGGTGAGCGCCTGACAGCGGCAATGCAGGTATTTATGGAC
TGCATCCGCAAATCCGGCCAGCCAGTGGAAAAACTCGATAAAACCCTGATTGACCACCATATCGCGGAGC
TGGATTTCCAAATCAGCCGCCAGCTGGATGCGGTGATGCATCATGCAGAATTCCAGAAAGTGGAATCCCT
GTGGCGCGGCCTGAAGCAACTGGTGGACAACACCGACTACCGCCAGAATGTAAAAACGGAAATTCTGGAT
GTGTCCAAAGACGACCTGCGCCAGGACTTCGAAGATGCGCCGGAACTTATCCAGAGCGGCCTGTACTGGC
ACACCTATACCGCTGAATACGACACCCCGGGCGGCGAGCCGATTGGCTCGGTTATTTCAGCGTACGAATT
TGACGCAAGTCCGCAGGACGTGGCGCTGTTGCGCAATATCTCGAAAGTCTCTGCCGCCGCGCATATGCCG
TTTATTGGTGCCGTCGGGCCGAAATTCTTCCTCAAGGAATCGATGGAAGAGGTGGCCGCGATTAAGGACA
TCGGTAACTACTTCGACCGTGCCGAATACATCAAATGGAAATCCTTCCGCGACACCGACGATGCCCGTTA
TATCGGCCTGGTGATGCCGCGCGTGCTGGGGCGCCTGCCTTACGGCCCGGACACGGTGCCGGTGCGCAGT
TTCAACTACGTTGAGCAGGTGAAAGGTCCGGACCACGAAAAATACCTGTGGACAAGCGCATCTTTCTCCT
TCGCCTCCAACATGGTGAAGAGCTTCATCAACAACGGCTGGTGCGTGCAAATTCGTGGCCCGCAGGCAGG
TGGGGCCGTGAAAGACCTGCCGATCCACCTGTACGATCTGGGTACCGGCAACCAGGTGAAGATCCCGTCA
GAGGTGATGATCCCGGAAACCCGCGAGTTTGAATTCGCTAACCTGGGCTTTATACCGCTGTCGTACTACA
AGAACCGTGATTACGCCTGCTTCTTCTCGGCGAACTCGGCGCAGAAACCGGCGCTGTACGACACCGCCGA
CGCCACTGCCAACAGCCGCATCAATGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGCATTGCGCATTAC
CTGAAGCTGATTCAGCGCGAAAATATCGGTACGACGAAAGATCGCCGTCTGCTGGAGCTGGAACTCAATA
CATGGGTACGCAGTCTGGTGACCGAAATGACCGATCCGGGCGACGAACTGCAGGCCTCACACCCGCTGCG
CGATGCGAAGGTGGTGGTGGAAGATATTGAGGACAACCCGGGCTTCTTCCGCGTGAAGCTGTTCGCGGTG
CCGCACTTCCAGGTGGAAGGCATGGACGTGAACCTGTCGCTGGTGAGCCAGATGCCGAAAGCGAAAGCGA
AAGCGTAA