SecReT6
Protein ID: 296102164
SecReT6 ID396
T6SS typei2
Gene symbol-
Locus tagECL_01803
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1821558..1822898 [+]
Producthypothetical protein
NoteTssK
UniProt IDD5C7Y0
KEGG IDenc:ECL_01803
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-134, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|296102164|ref|YP_003612310.1| hypothetical protein ECL_01803 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKTEQPLWGRGQMVSPQHFQQQAAYAAWSAECIARLGLSHPWGVIDATFEPDALKLGRLQARRLHIRFPD
GTLIDTDNADDLPPVLALESGSQDAVVVLALPLLRANGGNCLTPDAVAERPVRYRQRWRDIRNAFGDDTR
QIAVMKPELTLRFACQDNSDYLTCPVARLQQDSQGAWLLDETFLPPLLALQGSRWLMIQLEQLMSQLRVR
LSRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRHPQSPPERLYPELARLAGSLLTFSLE
HQVSAIPVWQHEQQNNVFPPLFDLLGDLLEASLPSRVVAIELEHDARLHFWQARLHDPRLREGADYYLSV
RSTVPVAQMQEQFPRQCKVGSPDHVRSIVNSSRVGVPLTPLRHVPAAIPLRLENQYFSLDVSHPQATEML
QGGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1821558-1822898 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCCAGATGGTCTCTCCCCAGCACTTCCAGCAACAGGCCG
CGTATGCGGCCTGGTCTGCGGAATGCATCGCCCGGTTAGGTCTCTCCCATCCCTGGGGAGTGATTGATGC
CACTTTCGAACCGGATGCACTGAAACTGGGCCGCCTGCAGGCTCGTCGTCTGCACATTCGTTTCCCTGAC
GGGACGCTTATCGACACTGATAATGCTGACGATCTTCCACCGGTTCTGGCGCTTGAGAGTGGATCACAGG
ATGCGGTGGTGGTGCTGGCCCTCCCGCTGCTGCGGGCGAATGGCGGCAACTGTCTTACACCCGATGCGGT
GGCCGAACGCCCTGTTCGCTATCGCCAGCGCTGGCGGGATATCCGCAACGCTTTTGGGGACGACACCCGC
CAGATTGCGGTGATGAAACCTGAGCTGACGCTGCGGTTTGCCTGTCAGGACAACAGCGATTATCTGACCT
GCCCGGTTGCCCGCCTGCAGCAGGATTCGCAGGGGGCATGGTTACTGGATGAGACGTTTCTTCCGCCACT
GCTGGCTCTGCAGGGCAGTCGCTGGCTGATGATCCAGCTGGAACAGCTGATGAGCCAGCTACGTGTACGC
CTGAGTCGGCTGATGGCCATGCGCCGGGAAAGTAATGAGCGGATGGCCGATTTTGCCGTGGCGGATGTGT
CCCTGTTCTGGCTGCTCAATGCCCTTAACAGCGCAGAACCCGTGCTCGGACAGTTTCAGCGCCACCCGCA
AAGCCCGCCGGAGCGTCTGTATCCGGAACTGGCACGCCTGGCGGGCAGTCTGCTGACTTTCTCGCTGGAG
CATCAGGTGAGTGCGATCCCGGTCTGGCAGCACGAGCAACAGAATAACGTATTCCCGCCGCTGTTTGATT
TACTGGGTGACCTGTTGGAAGCCAGCCTGCCGTCGCGGGTGGTAGCGATTGAGCTTGAGCATGATGCCAG
GCTTCACTTCTGGCAGGCCCGTCTGCATGACCCACGTCTGCGTGAAGGGGCTGATTACTACCTCTCGGTG
CGTTCAACGGTACCGGTGGCACAAATGCAGGAGCAGTTCCCGCGCCAGTGCAAGGTCGGCAGCCCCGATC
ATGTCAGAAGTATCGTCAATTCATCGCGGGTCGGCGTGCCTCTGACGCCGCTGCGCCATGTACCGGCAGC
CATTCCGTTACGTCTGGAAAATCAGTATTTCAGTCTTGATGTCTCTCATCCTCAGGCCACTGAAATGCTT
CAGGGTGGGACCTGCATGTTTTACGTTCCGGGCATGCTCGGCGAGCCTGAACTTGAACTCTTTGCGGTGC
TGAGAACATGA