SecReT6
Protein ID: 296102165
SecReT6 ID396
T6SS typei2
Gene symbol-
Locus tagECL_01804
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1822895..1823587 [+]
Productputative OmpA-family membrane protein
NoteTssL
UniProt IDD5C7Y1
KEGG IDenc:ECL_01804
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.80E-40, Aligned region: 14..217
Protein Sequence: 230 a.a.     [Download]
>gi|296102165|ref|YP_003612311.1| putative OmpA-family membrane protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSERKRGTAAAIDIDALLQDTWLQVISLRHGPTFQEGEGRTLWERCIADVERVQRELKASELDEASCQHI
LTAQCALLDEAVKGRGVEDDACVQWYDIPLQGHFLGTMDAGDTLCDRMRDVLREPAPDHAVVTCFQRVMM
LGFLGSYRSLNDPERQKLVNALSEYVTPFSYPQSYPVLAESHTGRGIMGGWLASWPVRIGLSVIVVAALW
WGLDRWLDQLLLTLLPGAVK
 
Nucleotide Sequence: 693 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1822895-1823587 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAGTGAGCGTAAACGCGGCACTGCCGCGGCCATTGATATTGATGCCCTGCTGCAGGACACCTGGCTTC
AGGTGATCAGCCTGCGTCACGGTCCGACGTTTCAGGAGGGCGAAGGGCGCACGCTGTGGGAGCGCTGTAT
TGCTGATGTCGAACGTGTGCAGCGTGAGCTGAAAGCGAGCGAACTCGATGAAGCCAGCTGTCAGCATATT
CTTACCGCACAGTGCGCCCTGCTCGATGAGGCGGTGAAAGGTCGTGGTGTGGAAGATGACGCCTGTGTGC
AGTGGTATGACATTCCCCTGCAGGGGCACTTCCTCGGCACTATGGACGCCGGCGACACGCTGTGCGATCG
GATGCGCGATGTGCTGCGTGAACCGGCGCCTGACCACGCTGTCGTGACCTGCTTCCAGCGGGTCATGATG
CTGGGTTTTCTCGGCAGTTACCGATCATTGAATGACCCGGAGCGCCAGAAACTTGTCAACGCACTCAGTG
AATATGTCACACCGTTCAGCTATCCACAGTCCTACCCCGTACTGGCGGAAAGTCATACCGGGCGGGGAAT
CATGGGCGGCTGGCTGGCGTCATGGCCCGTACGTATTGGTCTGAGCGTGATAGTGGTCGCTGCACTCTGG
TGGGGACTGGATCGCTGGCTGGATCAGTTGCTGCTAACCCTGTTGCCGGGGGCCGTGAAATGA