SecReT6
Protein ID: 296102166
SecReT6 ID396
T6SS typei2
Gene symbol-
Locus tagECL_01805
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1823680..1825107 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDD5C7Y2
KEGG IDenc:ECL_01805
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 8.90E-05, Aligned region: 406..459
Protein Sequence: 475 a.a.     [Download]
>gi|296102166|ref|YP_003612312.1| OmpA/MotB domain-containing protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MLILLVVLGGILAFWTVASRREQHDVTLRLEDLPDATYRQPVVLVCGDLPLAWPHSSPVLTVTQGCWIRV
EDHHDLAQVARQILWLRPDWGRQLSVMVSVCPQQHPDSEALTSRLLTLRWHISQLRKATGHSVPLVLNGQ
VGSAMTNDMFWQAVFPREGVRVWRESSAPGSVAEWVTSGGTPAVQQQVLMNSLMNWFRQHVQAVFMDENP
DVPVIAPVAVLWGMGPILAGSLATSAWTTWLSRHTAMQQVSGWQPVGTDSTVISLFPDFILPLLPEGRGL
IPRERTWRCAFGIFTLAAIAALLSSGWNNRQLLQRVSFDIVRYNSIAMDDYGPKASAVQVLREDAALLDE
HARNGVPARLGLGLYRGVRLRIPVLEAIRSYVPPPPPTKPVEKVAPKIIRLDSMSLFDTGKWALKPGTTK
LLVNSLVGIKAKPGWLIVIAGHTDSTGDDQSNQVLSLRRWWTGRAWCAATVYGRC
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1823680-1825107 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
GTGCTCATTCTGCTGGTGGTACTGGGGGGTATCCTGGCGTTCTGGACAGTCGCCAGTCGCCGTGAACAGC
ATGATGTCACCCTGCGCCTGGAGGATCTGCCTGACGCCACTTACCGTCAGCCCGTAGTGCTGGTTTGTGG
CGATCTGCCTCTGGCCTGGCCGCATTCGTCACCGGTACTCACTGTCACGCAGGGATGCTGGATCCGCGTG
GAGGATCATCATGATCTGGCGCAGGTCGCCCGTCAGATACTGTGGTTACGTCCTGACTGGGGACGTCAGC
TGTCGGTGATGGTCAGCGTCTGCCCGCAGCAGCACCCTGACAGCGAAGCCCTGACCAGTCGACTGCTGAC
CCTGCGCTGGCACATCAGTCAGCTGCGTAAAGCAACCGGTCACTCTGTGCCGCTGGTGCTGAATGGTCAG
GTCGGCAGCGCGATGACGAATGACATGTTCTGGCAGGCGGTTTTCCCGAGAGAAGGGGTGAGGGTCTGGC
GTGAATCTTCAGCCCCGGGGTCTGTTGCTGAATGGGTTACCTCCGGCGGAACGCCTGCGGTGCAGCAACA
GGTGCTGATGAATAGTCTGATGAACTGGTTCCGTCAGCATGTCCAGGCCGTCTTTATGGATGAGAACCCC
GATGTGCCGGTCATTGCACCTGTTGCGGTGCTGTGGGGAATGGGGCCGATCCTGGCCGGAAGCTTGGCCA
CATCGGCCTGGACGACGTGGCTTTCCCGTCACACCGCGATGCAGCAGGTGTCTGGCTGGCAGCCGGTGGG
AACGGACAGTACGGTCATCTCCCTGTTCCCGGATTTTATTCTGCCATTACTGCCGGAAGGGCGGGGCCTG
ATACCGCGTGAGCGAACCTGGCGTTGTGCGTTCGGGATTTTCACGCTGGCGGCCATTGCTGCACTGCTCA
GCAGTGGCTGGAACAACCGCCAGCTGCTGCAACGCGTGAGCTTCGATATTGTGCGTTACAACAGCATCGC
CATGGATGATTACGGTCCTAAAGCCAGTGCCGTACAGGTGCTGCGCGAGGATGCAGCGCTGCTGGATGAG
CATGCACGGAATGGTGTACCGGCCCGGCTGGGCCTGGGGCTTTATCGGGGAGTACGTCTGCGAATACCGG
TGCTGGAAGCGATCCGTTCGTATGTACCACCACCTCCTCCAACGAAGCCTGTAGAAAAGGTCGCGCCGAA
AATCATCCGCCTCGACAGCATGTCGCTGTTCGACACCGGAAAATGGGCGCTGAAACCCGGCACCACGAAG
CTGCTGGTGAATTCGCTGGTGGGAATTAAGGCGAAGCCCGGCTGGCTGATTGTGATAGCGGGTCATACCG
ACAGCACGGGCGATGACCAGTCCAACCAGGTGCTGTCGCTTAGGCGCTGGTGGACCGGCAGAGCCTGGTG
CGCTGCGACGGTTTATGGCCGCTGCTGA