SecReT6
Protein ID: 296102167
SecReT6 ID396
T6SS typei2
Gene symbolvasG
Locus tagECL_01806
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1825059..1827341 [+]
Producttype VI secretion system protein VasG
NoteTssH
UniProt IDD5C7Y3
KEGG IDenc:ECL_01806
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.30E-41, Aligned region: 112..131
AAA_2 [PF07724], Evalue: 6.30E-41, Aligned region: 486..651
AAA [PF00004], Evalue: 2.50E-20, Aligned region: 114..226
AAA [PF00004], Evalue: 2.50E-20, Aligned region: 491..614
AAA [PF00004], Evalue: 2.50E-20, Aligned region: 638..656
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 114..136
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 211..244
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 490..609
ClpB_D2-small [PF10431], Evalue: 2.40E-14, Aligned region: 259..282
ClpB_D2-small [PF10431], Evalue: 2.40E-14, Aligned region: 657..731
AAA_16 [PF13191], Evalue: 8.60E-13, Aligned region: 91..135
AAA_16 [PF13191], Evalue: 8.60E-13, Aligned region: 159..192
AAA_16 [PF13191], Evalue: 8.60E-13, Aligned region: 319..387
AAA_16 [PF13191], Evalue: 8.60E-13, Aligned region: 395..414
AAA_16 [PF13191], Evalue: 8.60E-13, Aligned region: 469..526
AAA_16 [PF13191], Evalue: 8.60E-13, Aligned region: 554..584
AAA_16 [PF13191], Evalue: 8.60E-13, Aligned region: 630..675
AAA_22 [PF13401], Evalue: 7.40E-10, Aligned region: 113..199
AAA_22 [PF13401], Evalue: 7.40E-10, Aligned region: 243..280
AAA_22 [PF13401], Evalue: 7.40E-10, Aligned region: 487..532
AAA_25 [PF13481], Evalue: 6.70E-09, Aligned region: 114..138
AAA_25 [PF13481], Evalue: 6.70E-09, Aligned region: 167..202
AAA_25 [PF13481], Evalue: 6.70E-09, Aligned region: 486..519
AAA_19 [PF13245], Evalue: 2.60E-08, Aligned region: 111..143
AAA_19 [PF13245], Evalue: 2.60E-08, Aligned region: 486..512
Arch_ATPase [PF01637], Evalue: 4.30E-07, Aligned region: 92..129
Arch_ATPase [PF01637], Evalue: 4.30E-07, Aligned region: 166..264
Arch_ATPase [PF01637], Evalue: 4.30E-07, Aligned region: 483..527
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 114..179
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 489..525
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 673..692
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 108..174
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 490..508
NACHT [PF05729], Evalue: 2.90E-06, Aligned region: 114..210
NACHT [PF05729], Evalue: 2.90E-06, Aligned region: 490..511
AAA_14 [PF13173], Evalue: 4.90E-06, Aligned region: 114..211
AAA_14 [PF13173], Evalue: 4.90E-06, Aligned region: 488..572
Sigma54_activat [PF00158], Evalue: 9.50E-06, Aligned region: 98..128
Sigma54_activat [PF00158], Evalue: 9.50E-06, Aligned region: 490..607
Zeta_toxin [PF06414], Evalue: 2.20E-05, Aligned region: 108..138
Zeta_toxin [PF06414], Evalue: 2.20E-05, Aligned region: 482..530
AAA_29 [PF13555], Evalue: 3.00E-05, Aligned region: 108..130
AAA_29 [PF13555], Evalue: 3.00E-05, Aligned region: 486..516
AAA_23 [PF13476], Evalue: 7.70E-05, Aligned region: 22..46
AAA_23 [PF13476], Evalue: 7.70E-05, Aligned region: 114..131
AAA_23 [PF13476], Evalue: 7.70E-05, Aligned region: 314..411
AAA_23 [PF13476], Evalue: 7.70E-05, Aligned region: 487..514
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 114..138
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 491..515
AAA_28 [PF13521], Evalue: 0.00032, Aligned region: 114..189
AAA_28 [PF13521], Evalue: 0.00032, Aligned region: 271..316
AAA_28 [PF13521], Evalue: 0.00032, Aligned region: 490..509
T2SE [PF00437], Evalue: 0.00049, Aligned region: 62..134
T2SE [PF00437], Evalue: 0.00049, Aligned region: 487..568
DUF2075 [PF09848], Evalue: 0.0018, Aligned region: 116..216
DUF2075 [PF09848], Evalue: 0.0018, Aligned region: 267..284
DUF2075 [PF09848], Evalue: 0.0018, Aligned region: 489..511
RNA_helicase [PF00910], Evalue: 0.002, Aligned region: 115..136
RNA_helicase [PF00910], Evalue: 0.002, Aligned region: 491..512
RNA_helicase [PF00910], Evalue: 0.002, Aligned region: 588..609
AAA_30 [PF13604], Evalue: 0.0023, Aligned region: 111..176
AAA_30 [PF13604], Evalue: 0.0023, Aligned region: 487..519
Mg_chelatase [PF01078], Evalue: 0.0051, Aligned region: 112..148
Mg_chelatase [PF01078], Evalue: 0.0051, Aligned region: 490..511
AAA_11 [PF13086], Evalue: 0.0091, Aligned region: 111..149
AAA_11 [PF13086], Evalue: 0.0091, Aligned region: 484..513
NTPase_1 [PF03266], Evalue: 0.0096, Aligned region: 114..138
NTPase_1 [PF03266], Evalue: 0.0096, Aligned region: 490..511
Protein Sequence: 760 a.a.     [Download]
>gi|296102167|ref|YP_003612313.1| type VI secretion system protein VasG [Enterobacter cloacae subsp. cloacae ATCC 13047]
MDRQSLVRCDGLWPLLTLGLSQLERLRPLLDAQSDEREEVQQEEELTQGCSVPLSGSEVKEGELNPALQN
ALDKFTLDVTANAREGKIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVP
ESLKTVSLRTLDLGLLQAGAGVKGEFEQRLKNVIDAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLL
KPALARGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAQHHGVHITDEA
VRAAVTLSRRYLTGRQLPDKAVDLLDTASARIRMSLDTVPEALTRLKAQLTALAMEKQALLQDIATGNTA
HGERLAAIEQDEVRIILQLDDLEAQYGQELKLTEALLACRSDISRQAEIADLQSQLATVQQGNPLLGLDV
DARTVATVIADWTGVPLSSLMKDEQTELLHLEEHLGKRVVGQGAALNAIAQRLRASKTGLAPENGPQGVF
LLTGPSGTGKTETALALADVLYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPY
SVVLLDEVEKAHRDVMNLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHIMQLLDEQPEATEGDLH
ELLRPSLRDHFQPALLARFQTVIYRPLAEAAMRTIVEMKLAQVSRRLSRHYGLTTKIDESLYDALTAACL
LPDTGARNIDSLLNQQILPVLSQQLLTHKAAGQKPQHLSLNWSEEAGIGLEFDCTEGAHA
 
Nucleotide Sequence: 2283 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1825059-1827341 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
GTGGACCGGCAGAGCCTGGTGCGCTGCGACGGTTTATGGCCGCTGCTGACGCTGGGGCTGAGCCAGCTTG
AGCGTCTGCGACCGCTGCTGGATGCGCAGTCAGACGAGCGCGAAGAGGTACAGCAGGAAGAGGAGCTGAC
GCAGGGCTGCAGCGTGCCGCTGTCCGGCAGTGAGGTGAAAGAGGGCGAACTGAATCCGGCCCTGCAGAAC
GCGCTGGACAAGTTCACCCTTGATGTCACCGCTAACGCGCGTGAGGGCAAAATCGACCCGGTTTTCGGCC
GTGATACGGAAATCCGCCAGATGGTGGATATTCTCTCGCGGCGTCGCAAGAACAACCCGATTCTGGTCGG
CGAGCCGGGTGTGGGGAAAACCGCCCTGGTGGAAGGGCTGGCGCTGCGTATCGCCGAAGGGAATGTGCCG
GAATCGCTGAAAACGGTGAGCCTGCGCACGCTGGACCTCGGTCTGTTACAGGCGGGGGCGGGCGTGAAGG
GGGAGTTTGAACAGCGCCTGAAAAACGTCATTGATGCGGTGCAGCAGTCTCCGTCCCCGGTGCTGCTGTT
TATCGACGAAGCGCACACCATTATTGGCGCAGGCAACCAGGCGGGCGGCGCGGATGCGGCCAACCTGCTG
AAACCGGCGCTCGCCCGCGGCGAACTGCGGACCATCGCGGCCACCACCTGGAGTGAATACAAGCAGTATT
TTGAGCGCGACGCGGCACTGGAGCGGCGCTTCCAGATGGTGAAAGTTGATGAGCCGGACGACGACACCGC
CTGCCTGATGCTGCGGGGGCTGAAATCCCGCTACGCGCAGCACCACGGGGTGCACATTACCGATGAGGCG
GTCAGGGCGGCGGTGACCCTTTCCCGTCGTTACCTGACCGGCCGTCAGCTACCGGACAAGGCGGTTGACC
TGCTGGATACCGCCTCCGCCCGTATCCGCATGAGTCTCGATACCGTGCCGGAAGCGCTGACCCGCCTGAA
GGCTCAACTCACGGCCCTGGCGATGGAAAAACAGGCGCTGCTGCAGGATATCGCGACAGGTAACACCGCC
CACGGCGAACGTCTGGCGGCCATCGAACAGGACGAAGTCCGCATCATTCTGCAACTTGATGACCTGGAAG
CGCAGTACGGCCAGGAGCTGAAACTGACGGAAGCCCTGCTGGCCTGCCGCAGTGATATCTCCCGCCAGGC
GGAAATCGCTGACCTGCAGAGCCAGCTTGCCACCGTGCAGCAGGGGAACCCGCTGCTGGGGCTGGATGTG
GACGCGCGTACCGTCGCCACGGTGATTGCCGACTGGACCGGTGTGCCGCTCTCCTCATTAATGAAGGACG
AGCAGACGGAACTGTTACACCTCGAAGAGCACCTCGGTAAACGCGTGGTGGGCCAGGGCGCGGCGCTGAA
TGCCATCGCGCAGCGCCTGCGCGCGTCAAAAACTGGGCTTGCGCCGGAGAACGGCCCGCAGGGCGTGTTC
CTGCTGACCGGACCGAGCGGCACCGGCAAGACCGAAACCGCGCTGGCGCTGGCGGACGTGCTGTACGGCG
GTGAAAAATCCCTGATTACCATCAACCTCTCCGAATACCAGGAGCCGCACACCGTCTCCCAGCTTAAGGG
TTCCCCGCCGGGCTACGTCGGTTACGGTCAGGGCGGTATTCTCACCGAGGCAGTGCGCAAGCGCCCGTAC
AGCGTGGTGCTGCTCGATGAAGTGGAGAAAGCGCACCGTGACGTGATGAACCTGTTCTACCAGGTCTTCG
ACCGCGGCTTTATGCGCGACGGCGAGGGGCGTGAAATCGACTTCCGTAACACGGTAATTCTGATGACCTC
CAACCTCGGCAGCGACCACATCATGCAGCTGCTGGATGAACAGCCGGAGGCAACAGAAGGTGACCTGCAT
GAACTGCTGCGTCCGAGCCTGCGTGACCACTTCCAGCCTGCGCTGCTGGCGCGTTTCCAGACGGTGATTT
ATCGTCCTCTGGCGGAGGCCGCCATGCGCACCATTGTGGAAATGAAGCTCGCACAGGTGAGCAGGCGGCT
GAGCCGACACTACGGTTTGACCACCAAAATTGATGAGAGCCTGTACGACGCGCTGACCGCGGCCTGCCTG
TTGCCGGATACCGGTGCGCGTAACATCGACAGCCTGCTGAACCAGCAGATTTTACCGGTGCTGAGCCAGC
AGTTGCTGACGCATAAGGCGGCGGGGCAAAAGCCACAGCACCTGTCCCTCAACTGGAGTGAGGAGGCGGG
GATCGGACTGGAGTTTGACTGCACAGAAGGAGCGCACGCATGA